Conserved Protein Domain Family
ureacarb_perm

?
TIGR03428: ureacarb_perm 
permease, urea carboxylase system
A number of bacteria obtain nitrogen by biotin- and ATP-dependent urea degradation system distinct from urease. The two characterized proteins of this system are the enzymes urea carboxylase and allophanate hydrolase, but other, uncharacterized proteins co-occur as genes encoded nearby in multiple organisms. This family includes predicted permeases of the amino acid permease family, likely to transport either urea or a compound from which urea is derived. It is found so far only Actinobacteria, whereas a number of other species with the urea carboxylase have an adjacent ABC transporter operon.
Statistics
?
PSSM-Id: 132469
View PSSM: TIGR03428
Aligned: 4 rows
Threshold Bit Score: 653.447
Threshold Setting Gi: 499522114
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011075113  29 DLSSFGYEQQLQRNLGRFASFAAGFSFVSILTTIFQLFGLGFGFGGPAFFWTWVAVFIGQYMVALCFAELAARFPVSGAI 108 Corynebacterium...
WP_011598656  75 DLGEFGYEQQLHRSLGKFASFAAGFSFVSILTTIFQLFGLGFGFAGPAFFWTWPVVFVGQFMVALNFAELAARYPISGAI 154 Rhodococcus jostii
WP_011772960  16 DLTALGYQPTLHRKLGRYASFAAGFSFVSILTTIFQLFAFGYSFAGPAFFWTWPVVLVGQLLVALNFAELAARYPLSGAV 95  Arthrobacter au...
WP_011208754  19 dLQRFGYQPVLHRKLGRYASFAAGFSFVSILTTIFQFFGFGYGFGGAAFFWTWPVVFAGQLLVALNFAELAARYPISGCI 98  Nocardia farcinica
WP_011075113 109 YQWSRRMGGEFIGWFAGWFMILAQIVTAAAAAIALQVVLPNIWSGFQIIGDDPTLTSPSGAANAVLLGSVLIVLTTVINC 188 Corynebacterium...
WP_011598656 155 YQWSRRMGGEVVGWFAGWFMILAQMVTASAAAIALQVVLPNVWSGFQIIGEDSTLTSASGAANAVLLGSVLLVLTTFINC 234 Rhodococcus jostii
WP_011772960  96 YQWSRRMGGEVVGWFAGWFMSIAQVITAAAAAIALQVVLPQLWDGFQVVGGDPSLTSPTGAANAVILGAVLLVITTVINC 175 Arthrobacter au...
WP_011208754  99 YQWSRRLAGETIGWFAGWMMIIAQIVTAAAAAIALQVVLPSIWSGFQIIGEDTALTSPSGAMNAVLLGSVLLILTTLVNV 178 Nocardia farcinica
WP_011075113 189 IGVRWMSYVTTIGVVCELVGVVAIIGVLFAHAQRGPQVVFETN-WTGDSSGYIG-AWIASALMAAYVMVGFGSAGELAEE 266 Corynebacterium...
WP_011598656 235 IGVNWMSRINNIGVTCEIVGVIAVIGMFLTHAQRGPEVVFDTG-TAGASPGYGW-AWIVSGLMAAYVMVGFGSAGELAEE 312 Rhodococcus jostii
WP_011772960 176 LGVKLMSHVNSIGVTCEIVGVAAVILALFSAAQRGPGVVADVSvVTTSDLGAVG-AFLVSGLMAAYVMVGFNSAGELSEE 254 Arthrobacter au...
WP_011208754 179 VGIEWMSRLNTIGVTIEIVGVLAAIGVFFTHVERGPGVVLDT---TAAAPGPYWaAFLVSGLMAAYVMVGFDSAGELSEE 255 Nocardia farcinica
WP_011075113 267 TRNPRAVAPKTIRQALSVSALGGGLLILGALMAAPSLTDGRLSVEGLPYVLNTVLESPWGTVLLIDVAIAILICTLAIQT 346 Corynebacterium...
WP_011598656 313 TRNPRRVAPRTIRLALSVSALGGGLMIIGALMAAPSLTDGRLAAEGLPYVLSSILSSPWGTLLLVDVAIAVFVCTLAIQT 392 Rhodococcus jostii
WP_011772960 255 TKNPRKTAPRTILSALIISGIGGGLMIIAALMAAPSLDDGRLATEGLPYVLTAVLGTFWGKVLLVDVAIAIFVCTLAIQT 334 Arthrobacter au...
WP_011208754 256 TKNPRRVAPRTILTALSVSALGGGLMLLGALMAAPSLTDGMLAADGLAYVISAKLDSPAGTLLLGCVAVAILVCTLAIQT 335 Nocardia farcinica
WP_011075113 347 AASRLMFSMARDHRLPASRMLSRVNTTTGTPILPSIVVGVACILILLINVGNDALFATITSVCIILIYLAYLLVTAPLLL 426 Corynebacterium...
WP_011598656 393 AASRLVFSMARDGRLPASQILSTVNTRTGTPIAPSVLIGLVCIGILAVNVGNSAIFATLSSVCIILIYLAYLMVTVPLLL 472 Rhodococcus jostii
WP_011772960 335 AGSRLVFSMARDGKLPASALLSRVHPQRGTPMWPSIAIGALAVGILAINIGNSALFTTLCSVCIVMVYLAYLMVTVPQLL 414 Arthrobacter au...
WP_011208754 336 AGSRLMFSMARDGKLPFAAQLAAVHPRFGTPVLPAVVIGVLGITLLLVNLGNAAIFSTLASVCIVTLYVAYLLVTVPLLV 415 Nocardia farcinica
WP_011075113 427 RRIQG-WPydRGTSTDANGkqLFTLGRWGLPVNICAVVYGTVMVVNLSWPRAEIYNPSGDTPIMQWAGPIAVGAVIILGL 505 Corynebacterium...
WP_011598656 473 RRLKG-WPh-GGPQVDADGrkLFSLGRFGLPVNILAVGYGALMVVNLSWPRAEIFDPSGDYPLLRWAAPVTVAAVVALGF 550 Rhodococcus jostii
WP_011772960 415 SRFRGdWR--RVGQTMPGG--LFSLGRWGLPVNILAVLYGALMVVNLSWPRPEVYDPSGEHGILLFSAPIMVGAVLLLGI 490 Arthrobacter au...
WP_011208754 416 RRLRG-WP---ADETAPAG--LFRLGRFGIPVNLLAVVWGLAMVVNLAWPRPEVYTPEGGGWWMLWSAPLFLAATvgvgv 489 Nocardia farcinica
WP_011075113 506 MA 507 Corynebacterium efficiens
WP_011598656 551 AC 552 Rhodococcus jostii
WP_011772960 491 WV 492 Arthrobacter aurescens
WP_011208754 490 vv 491 Nocardia farcinica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap