Conserved Protein Domain Family
urea_degr_2

?
TIGR03425: urea_degr_2 
urea carboxylase-associated protein 2
A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes.
Statistics
?
PSSM-Id: 163257
View PSSM: TIGR03425
Aligned: 19 rows
Threshold Bit Score: 313.86
Threshold Setting Gi: 500096952
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011491906  15 VAWETVIPAGTHWSGVLRRGMALRAVDSEGGANLAAVFHRHDEPLERYNMADTLKAQHTAHLTRGHVLYSDMGRVLASIT 94  Burkholderia xe...
WP_011682643   6 VLWEETVQPGATWSHVLKRGTALRITDVEGGANAGAIFYNFECPVERYNMPDTLKAQHIAHLTAGHVLYSDMGRILCSVT 85  Candidatus Soli...
WP_011138996   9 ILLQEILPGGARWSKIIHRGSKIRLITPEGKGSLSALFYNADNTAERYNSADTMKIQWNAFLGKGKVLFSEQGRILFSIT 88  Wolinella succi...
WP_011140962  14 ITWAETVPGGAYWSRKIKRGATLRIVDLEGGQGVSLLCYNADNPIERYNAADTVKIQFGIFLGVGKVLYSDMGRVLFSIT 93  Gloeobacter vio...
WP_011444269  45 LVWEETIAAGGYATRRLSRGTRLRLVDIKGDACASLLLFNAEMPTERLNVADTVKVQWNAYLGQGKLLLSDMGRVLMSIV 124 Novosphingobium...
WP_011474933  49 IIHRETVPGGWYFVTKLNRGEALRIVNSSGKSCVSLLAWNAADTSERLNHADTIKVQWAASLRKGRVILSDMGRALLSIV 128 Rhodopseudomona...
WP_011427977  49 iiHQETIPGGWYWSTKLLRGEAIRIDQGEGNSTVALVAWNAEDTSERINLVDTAKVQWTTALGKGRVIFSDMGRVMFSII 128 Rhizobium etli
WP_006769607  61 LTWAETVAPGGYTHKVVQRGTRIRLEDVSGNACAHVLLFNADAPWERFNAADTIKIPWQAYPTEGHPLLSGEGRVLATVV 140 Corynebacterium...
WP_010988100  42 LVWAETVAGGNYTHRVLARGTELRLTDLRGDACAHLLLYVADRPWERLNVADTVKVQWNAYLGEDRLLLSDQGRVLASVV 121 Streptomyces av...
WP_029104257  49 LTWAETVPGGRYTTKVLARGTRLRLRDLTGTACAHLLLWRADAPWERLNVADTVKVPWQAYLSTGHPLLSDQGRVLATIE 128 Mycobacterium s...
WP_011491906  95 ADTL-G-WHDPLGGVGDAQLFASKYGVARYQQHRNAMIRNGRDSLLLELAKHGLGARDLVANINFFSKLAIGEDGALSFV 172 Burkholderia xe...
WP_011682643  86 EDTV-G-WHDPIAGCSNGKLVAARYGEARYQEVRNECHRNALDSFLVELGKWGLGPRDLVPNVNFFSKVSVAEDGGMHFQ 163 Candidatus Soli...
WP_011138996  89 EDTT-GgMFDALCGMSHPKLLEERFGKGDFEALRNGYYKSDRENFLVELGKYGMGKRDIMPCLNLFRQVEVKEGSRLSLS 167 Wolinella succi...
WP_011140962  94 GETTgG-AFDTLGGASNPAGSTQKYGEGD--------WRDTRSNFINALAKHDLGKKDIMPNLNLFARVAVEEDGGLTFQ 164 Gloeobacter vio...
WP_011444269 125 EDDA-G-THDAFCGTSNAASNAARYGDGRNSGS----FPNGRDRLLLGAAKHGLQRRDVHPCVNLFKGAAIEADGTIVPD 198 Novosphingobium...
WP_011474933 129 EDTS-G-AHDTLAGCSNAATNAARYGEG---------FRNSRDNFLLAAGKLGLARRDVHPCVAFFAPVSVDADGRFEWH 197 Rhodopseudomona...
WP_011427977 129 EDSS-G-AHDCLMGGSTAASNAAKYPGEK--------TRNTRDNLIIIAVKLGLDRRDIPGILNLFAPVRLAEAGGFGWQ 198 Rhizobium etli
WP_006769607 141 GDTS-H-HHDALCGVMSDTMTREKYGDPRIHGV----YPSGQSLFEQAGVKHGLTSRDIPPSIAFFKGTTIAADGGMHF- 213 Corynebacterium...
WP_010988100 122 ADTS-G-RHDALCGTSTLVRNTERYGDGTPQSA----SPAGRELFKLAAAKNGLEPRDLPPSLSFFQGVEVRDDGTLDF- 194 Streptomyces av...
WP_029104257 129 SDTS-G-HHDALCGTTTLAGNTAKYGAGSAESA----SPAGRELLALAALKNGLTRRDVAPSVSFFHGIWVDGDGALV-S 201 Mycobacterium s...
WP_011491906 173 AGHSPAGAAFDLRFEMDTLVAFSTAPHPLNPSSEYEPKPVKLIAYRAyatdACVPADDFCRSACPENERGFVNTDRLFV 251 Burkholderia xen...
WP_011682643 164 PGHSRAGDYVELRAEMNVLTIVNTCPHPLDPNPKYQPKPIRLTLRKV----APPAADDACRLSRPENERGFVLTERYFL 238 Candidatus Solib...
WP_011138996 168 PKLPSAGSYIELRAEMNILLVLSNTPHVLD-EGRYAPSPIELLIYKA----EPLGEDDYCLNSGPEARRGFENNARYFA 241 Wolinella succin...
WP_011140962 165 -ERSKAGSTVDLRAEMNVLVVISNTPHVLHPSPTYQPTPVRVVVWNS----PPPTSGDPCRTGCPEAVRGFENTDALFV 238 Gloeobacter viol...
WP_011444269 199 VGPFPAGRRMVLRAEMDVIVVIANCPHVLDPRPEWTSTPLRATAWRG----PVTPQDDPIRTATPEGLRAYLNVEDYFr 273 Novosphingobium ...
WP_011474933 198 GERRTAGDFVDLRAEMDLLLALSNCPHPLDPSPAYAPGDVELIRTQA----PPVAADDLCRSASLEAKRAFENNATWLN 272 Rhodopseudomonas...
WP_011427977 199 GKRSNSGDYVELRAEMDMLVGFSTCPHPLDPDPAYQPKPVVITRYKA----AAPAADDLCRTATAEAVRGFENNTLMQA 273 Rhizobium etli
WP_006769607 214 TGGAGAGTTVDLLAELPLIILVANSPHPLDPHTDYVSGPLRVHAWRS----DPTGPSSPWYAASPERQRAYLNTIDYAe 288 Corynebacterium ...
WP_010988100 195 TGSAGPGGSVTLRAEQDLTVLIANVPHPADPRTDYVSTPLEVLAWRA----DATRPGDPLWEATPEGRRALLNTAEFLA 269 Streptomyces ave...
WP_029104257 202 TGSAGADTAVELILHLPLIVAIANTAHPLDPAPEFEVGSLEVLAWRAq--eDLAGIGASLHDRDPEYQRAYLNSEDVWs 278 Mycobacterium sm...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap