Conserved Protein Domain Family
urea_degr_1

?
TIGR03424: urea_degr_1 
urea carboxylase-associated protein 1
A number of bacteria degrade urea as a nitrogen source by the urea carboxylase/allophanate hydrolase pathway, which uses biotin and consumes ATP, rather than my means of the nickel-dependent enzyme urease. This model represents one of a pair of homologous, tandem uncharacterized genes found together with the urea carboxylase and allophanate hydrolase genes.
Statistics
?
PSSM-Id: 132465
View PSSM: TIGR03424
Aligned: 17 rows
Threshold Bit Score: 375.918
Threshold Setting Gi: 493822105
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011112887  15 HAVINEICDAGEPWVKEIKKGQIFRIVDLEGNQAVDTLFYNAHDAMERYSATDTVRRQHRLYLTTGSKLYSNFGNVMLVI 94  Nitrosomonas eu...
WP_011140961  13 RVVYDEVLAARRPWSHVVERGQVLRIVDLGGNQAVDFLVYNADDYSERYSAPDTIRLQGNIFLTTGSRLYSNDGGVLMTI 92  Gloeobacter vio...
WP_011138997   6 NAIHQERVAAGIPWYRVVKKGEVIRIIDLLGCQAVDTLFYNAHNHEERYSAPDTIREQGSIFITKGTKLYSSEGNVMLEV 85  Wolinella succi...
WP_011427976  15 NAVQDHFIPAEAPWSGVVRKGQTIRIEDSLGQQAIDTLFYRADDFSERYSNQDTMRMQGAAYIGIGTKIMSNEGNVMLTM 94  Rhizobium etli
WP_011682642  12 DAVYSAIIPAGEPWMRVVHRGQYFRIVDLRGNQAVDTLFYNARDTADRYSAQDTIREQSNIYLTTGTRLISTRGTVLLTI 91  Candidatus Soli...
WP_011156969   9 RIVLDTEIPARVPWSAIIRKGQTLRIVDSHGQQAVDTLFYAADDHGERYSGQDTLRAQGSAYVTTGTRIMSTEGRTMLRM 88  Rhodopseudomona...
WP_010919694  10 DIVHDEVVPARAPWLHAVKAGQTLRIVDLEGNQAVDFLVYSAADDAERYSAQDTIAAQKNIFLREGSVLLSNEGAAMMTV 89  Caulobacter vib...
WP_011589170  11 QAFFREEVAAGDYFIRIIKKGQTVRLLDLEGNQAADTLFYNAADPAERYSAVDTIREQGNVYLTAGTVLMSNRMNPLLKI 90  Alcanivorax bor...
WP_003893561   8 QIIADETVAPRAPWSKIVRAGDVLTIVDLHGNQAVDTLFYGADDHGIRYSAPATIAAQGNIFLTTGTVLRDSDGAPMLTI 87  Mycobacterium s...
WP_011772958  15 KVVLDELVEARGPWSAVVAAGDILTIVDLDGNQAVDCILYAAHDTGTRYSAAATIAGQGSIFLTTGSILRADSGRELMTV 94  Arthrobacter
WP_011112887  95 TADTCGRHDTVGGACAAESNTTRYALDKYPMHSCRDSFLYALAHdpvcerL---GMSKRDVPANINFFMNVPVTEAGKLE 171 Nitrosomonas eu...
WP_011140961  93 VGDSVGRHDTSGGACSCESNSVRFGLDKKYQHACVENFLAALSR------Y---GMGKRDLVSNINFFMNVPVSRDGTLE 163 Gloeobacter vio...
WP_011138997  86 LEDTCGNHDTLGGHCSAESNTVRFGHDKKYMHSCRDNYLFAIGE------L---EMNPRDLTNNINFFMNVPVEENGHLA 156 Wolinella succi...
WP_011427976  95 TADSCGRHDTSAGACSCESNTVRFGHGTKYLHACRDNFVLEVSK------H---GMGKRDIVPNINFFMNVPIKPTGEMT 165 Rhizobium etli
WP_011682642  92 VADTCGRHDTLGGACANESNMVRYAIEKRHMHACRSSFLKAVID------Wd-rGMEKRDIASNINFFMNVPVTPEGGLT 164 Candidatus Soli...
WP_011156969  89 VADSCGLHDTSAGACSCESNTVRFGHQTKYLHACRENFVLEAAK------H---GLSKRDIVPNLNFFMNVPLDPDGNFT 159 Rhodopseudomona...
WP_010919694  90 TATAVAYHDTIGGACSCESNTLRYGHHTKAQHACVENFLVANAR------Q---GRGKRDMVSNVNWFMNVPVEADGALG 160 Caulobacter vib...
WP_011589170  91 VADTCGRHDTLGGACATESNTVRYSLEKRCMHACRDSWMLAINQ------HpefHLAKQDITHNINFFMNVPVTAEGGLT 164 Alcanivorax bor...
WP_003893561  88 IDDEVGNHDTLGGACSQESNTLRYGHHTKHQHACVENFIGEGAR------W---GLTKADIVSNINFFMNVPVDPDGSLG 158 Mycobacterium s...
WP_011772958  95 VADEVGVHDTIGGACSQESNTLRYGQHTHEQHACVENFLIEGAK------W---ELGKKDLVSNINWFMNVPVDPDGALG 165 Arthrobacter
WP_011112887 172 FADGVSAPGKYVEMRAEMDVVVLISNCPQLNNPCNAYNPTPVRLLVW 218 Nitrosomonas europaea
WP_011140961 164 IVDGISEPGSTVDLRAEMNALVVISNCPQMNNPCNGYNPTPIRLVIW 210 Gloeobacter violaceus
WP_011138997 157 IVDGISKAGDYVEMEAKMDTLVLISNCPQLNNPCNGFNPTPIEILIW 203 Wolinella succinogenes
WP_011427976 166 IVDGISAPGDYVELVAEMDVLCVISNCPQINNPCNGFDPTPIRVLIW 212 Rhizobium etli
WP_011682642 165 FEDGISEPGKYVEMRAETEVLAMISNCPQLNNPCNAYDPTPVQVLIW 211 Candidatus Solibacter usitatus
WP_011156969 160 VVDGVSKPGDYVEMVAEMDVLCLISNCPQVNNPCNGFFPTPIQVVIY 206 Rhodopseudomonas palustris
WP_010919694 161 IVDGISAPGLFVDLRAEMDVVVVVSNCPQINNPCNGFNPTPVRMIIa 207 Caulobacter vibrioides
WP_011589170 165 FEDGISAPGKYVELTACMDTLILISNCPQLNNPCNGYNPTPIDVLIW 211 Alcanivorax borkumensis
WP_003893561 159 IVDGLSAPGKKLSLRAEIDTLVLISNCPQINNPCNGFDPTAVRMVVT 205 Mycobacterium smegmatis
WP_011772958 166 IVDGLSAPGKRVALRAEVDTLVLVSNCPQINNPCNGFNPTPVRMIVT 212 Arthrobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap