Conserved Protein Domain Family
NifU_clost

?
TIGR03419: NifU_clost 
FeS cluster assembly scaffold protein NifU, Clostridium type
NifU and NifS form a pair of iron-sulfur (FeS) cluster biosynthesis proteins much simpler than the ISC and SUF systems. Members of this protein family are a distinct group of NifU-like proteins, found always to a NifS-like protein and restricted to species that lack a SUF system. Typically, NIF systems service a smaller number of FeS-containing proteins than do ISC or SUF. Members of this particular branch typically are found, almost half the time, near the mnmA gene, involved in the carboxymethylaminomethyl modification of U34 in some tRNAs (see GenProp0704). While other NifU proteins are associated with nitrogen fixation, this family is not. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132460
View PSSM: TIGR03419
Aligned: 15 rows
Threshold Bit Score: 202.279
Threshold Setting Gi: 552918799
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011406590   3 YSDKVVDHYTNPRNTGVIKNPDGEGTVGNPVCGDIMTIYIKVDDDnKLSDVKFSTFGCGAAIATSSMITEMAIGMDVDEA 82  Methanosphaera ...
WP_011449177   2 YSEKVMDHFMNPRNQGEIPDADGVGEVGNPTCGDIMRIFLTVKDN-IITDVKFQTFGCGAAVASSSMATELIKGKTLEEA 80  Methanospirillu...
WP_011307391   3 YSLKVMDHFSNPRNMGSIENSDGVGEVGNAKCGDIMKIYLKVEDN-RIADVKFQTFGCGAAIASSSMATEMIKGKTLEEA 81  Methanosarcina ...
WP_011022677   3 YSAKVLDHFSNPRNMGSIANCDGVGEVGNAKCGDIMKIFLKVEGD-RIVDVKFQTFGCGAAIASSSMATELIKGKILKEA 81  Methanosarcina ...
GAF24783       5 YSEKVMDHFTNPRNVGEIENADGVGQVGNPVCGDIMRLYIKVEDG-IIKDVKFKTFGCGAAIATSSMVTEMVKGKTVEEA 83  Moorella thermo...
WP_028052417   2 YSEKVMDHFTNPRNVGEIPDADGVGEVGNPSCGDIMRIYIKVDGD-KITDVKFKTFGCGAAIATSSMVTEMVKGKTIEEA 80  Carboxydothermu...
WP_021381678   3 YSDKVMEHFMNPRNMGEIDNASGVGEVGNPTCGDIMKIFLDIDGD-VIKDVKFKTFGCGSAIASSSMATEMIKGKTIKDA 81  [Clostridium] d...
WP_011341602   2 YSDKVIDHFTNPRNVGEIENADGVGEKVSSSCGDRMKVFLKVEND-IIEDVKFQTYGCGAAIASSSMMSELVIGKTLQQA 80  Pelobacter carb...
WP_011032064  15 YNKKVMDHFMNPRNVGEIENADGIGEAGNP-HGDQMKIFLKIRDN-RIEDVKFKTFGCAAAIASSSMATEMIKGKTLEEA 92  Methanosarcina ...
WP_011308126   2 YNKKVMDHFMNPRNVGEIEDANGVGEAGNP-HGDYMKIFLKIRDD-RVEDAKFKTFGCAAAIASSSMATELIKGKTLKEA 79  Methanosarcina ...
WP_011406590  83 YHITRNDVADELDGLPPIKLHCSNLAADALQAAIENYREKKE 124 Methanosphaera stadtmanae
WP_011449177  81 WEVSNKAVAEALEGLPPIKMHCSVLAEEGIHKAINDYRIKNG 122 Methanospirillum hungatei
WP_011307391  82 WKLSNKAVAEALDGLPPIKMHCSMLAEEAIHEAINDYLKKKG 123 Methanosarcina barkeri
WP_011022677  82 WELSNKAVAEALDGLPPIKMHCSMLAEEAIHEAINDYLQKKG 123 Methanosarcina acetivorans
GAF24783      84 LKISNAAVAEALDGLPPQKMHCSNLAADALHKAIEDYQNRNk 125 Moorella thermoacetica Y72
WP_028052417  81 MKITNKAVADALDGLPPQKMHCSNLAADALKVAIEDYLKKKG 122 Carboxydothermus ferrireducens
WP_021381678  82 LELTNKAVAEALDGLPPVKMHCSVLAEQAVKAALIDYAQKNN 123 [Clostridium] difficile
WP_011341602  81 LDLTNDQVADALGGLPAPKLHCSNLAADALHEAIKNYQETNA 122 Pelobacter carbinolicus
WP_011032064  93 WELTDEAVAEALEGLPPGKLECSVVSREATHRAINDYRKKQG 134 Methanosarcina mazei
WP_011308126  80 WELTNEDVAEALEGLPPGKLECSVLSREAIHSAINEYRRKQG 121 Methanosarcina barkeri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap