Conserved Protein Domain Family
iscX_yfhJ

?
TIGR03412: iscX_yfhJ 
FeS assembly protein IscX
Members of this protein family are YfhJ, a protein of the ISC system for iron-sulfur cluster assembly. Other genes in the system include iscSUA, hscBA, and fdx. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132453
View PSSM: TIGR03412
Aligned: 27 rows
Threshold Bit Score: 91.9638
Threshold Setting Gi: 490297075
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002222472  2 KWTDTQRIAEELYDLHGETiDPRTVRFTQLRDLIMALPEFDDDPARCGERILEAVQQAWIDEAE 65  Neisseria meningitidis
WP_011287704  2 KWTDINDIAIELCDAHPDK-DPLKINFVDLRDWVMALPGFNDDPKHCGEKILEAIQQAWIDEVA 64  Dechloromonas aromatica
WP_011134642  2 KWTDVNDIAIELADAHPDV-DPKTVRFVDLHNWVVELPGFDDDHARGGERVLEAIQQAWIDEAE 64  Chromobacterium violaceum
ESP82957     15 KWVDVLEIAIQLAESKPEV-DPRYVNFVDLHRWVLALPEFSDDPSRGGEKVLEAIQAAWIDEAD 77  Pseudomonas putida S12
WP_011239434  2 KWTEVQEIAIQLSERHPET-DPAKVNFVDLMKWTMALPEFDDDPKHCGERVLEAIQQAWIDEVA 64  Aromatoleum aromaticum
WP_011494740  4 RWIDSQEIALALIDKHPEV-DPTALHFPELMQWILALEDFDDDPKHCGEKVLEAVQMAWIDEAD 66  Shewanella denitrificans
WP_011044994  6 lWSDSQEIALDLIEEHPNV-DPFKLHFTDLRQWVLDLERFDDDPKHCGERVLEAIQLAWMAEVD 68  Colwellia psychrerythraea
WP_011072283  4 KWIDSLDIALELLEKHSEV-DPRKLHFTELYQWVLALEDFGDDPKHCNEKVLEAIQQCWIEEK- 65  Shewanella oneidensis
WP_011217511  4 KWTDSRELAIELSEVYPDT-DPKLILFTDLRQWILDLEEFDDDPKHCSERVLEAVQMCWMEEED 66  Photobacterium profundum
WP_011000978  2 KWNDIQQIAEALYDQYPDV-DPTRLNFVDLHNKVVSLDGFDDDHKRGGEKFLEAIQQAWIDEAA 64  Ralstonia solanacearum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap