Conserved Protein Domain Family
urea_trans_UrtC

?
TIGR03408: urea_trans_UrtC 
urea ABC transporter, permease protein UrtC
Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 132449
View PSSM: TIGR03408
Aligned: 18 rows
Threshold Bit Score: 352.723
Threshold Setting Gi: 499281691
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011569690  29 PLALDTFRLNLFGKYLTYAFVAVGLVLCWGAGGILSLGQGVFFGLGGYCMAMFLKLEASTPENTaiqstpG---IPDFMD 105 Roseobacter den...
WP_011481529  28 PLSLDLFRLNLVGKYLSYSFVALGLVMLWGYGGVLSLGQGVFFGLGGYGMAMFLKLEASDPVTTkiqstpG---IPDFMD 104 Polaromonas sp....
WP_011321040  27 PLVLSEFRLNLLGRFLSLAIVALGIDLIWGYTGLLSLGHGIFFGLGGYAIAMYLKLQIPEGE------------LPDFMG 94  Anabaena variab...
WP_010896431  28 pfflSDFRTNLLGRYIAFAILVLGLDLLWGYTGVLSLGHGIFFGLGAYIMAMYLSLEGMTG---------A---VPDFML 95  Bacillus halodu...
WP_011365538  28 LFGFSQFRLNLFGRYFSLAFVALGIDLIWGYTGLLSLGQGIFFSLGGYAIAMHLLLVTKNDFTT------GangLPKFFE 101 Synechococcus s...
WP_011584644  29 LGFVSNNTISLWGRYFCFAIAALGVDLIWGYSGVLSMCQAVFFCLGGYAIAMHMLLVAGGEDPS------G---IPDFMV 99  Cytophaga hutch...
WP_011231421  19 PFYLTEFRLSLLGKFLCFAIVAVGISLIWGYTGILSLGHGVYFGLGAYCMAMYLKLEASQGH------------LPDFME 86  Geobacillus kau...
WP_011131591  27 pavvsvFGLNLLGRFLSLSIVALGIDLIWGFTGLLSLGQGIFFALGGYAAAMYLQLNSSSEQPN------G---IPEFFG 97  Prochlorococcus...
WP_003894360  26 PAVLSDFRLSLLGKFLCFAIVAVGIGLAWGRGGMLVLGQGVFFGLGGYMMGMHLKIADAEIRHQ------A---VPDFMQ 96  Mycobacterium s...
WP_010982630  32 PLALSDFRLGLLAKYLCTAMVAVGICLAWGRGGLLTLGQGVFFGLGGYAMAMHLKIVDAGPGT-----------IPDFMQ 100 Streptomyces av...
WP_011569690 106 WNQ-LTALPWWWEPFNNLAFALFAVVAVPVIFAFIIGVAMFRRRVGGVYFAIITQAFAAILTILIIGQQGFTGGVNGI-T 183 Roseobacter den...
WP_011481529 105 WNQ-ITALPLWWEPFRSFPLTLLLILVVPTFLAFIIGYAMFKRRVGGVYFAIITQAVALILTVLIIGQQGYTGGVNGM-T 182 Polaromonas sp....
WP_011321040  95 LYG-VTELPWFWRPFYSFPIAVATVVIVPGLLAGLLGYLVFRNRIKGVYFSILTQAAIIVFFNFFNGQQQFFNGTNGL-I 172 Anabaena variab...
WP_010896431  96 WNG-ITGLPLLWQVFSNPFIAIIGAVTIPMLIASLLAFFTFRNRIKDVYFTILTQALVLVMVTLIVSQQSITGGTNGL-T 173 Bacillus halodu...
WP_011365538 102 NYG-VDQLPFFWEPFWSFPVSIAAIFIVPSIVAGLVGYLIFRNRIKGVYFSIITQASLMVFYHFFNGQQKLVNGTNGLkT 180 Synechococcus s...
WP_011584644 100 WNQ-VDVLPAFWIPFHSFGLSFLLALLIPGIFAFIFGYFVFRSRIKGVYLAIITQALALAMWLIFLRNETMLGGTNGL-T 177 Cytophaga hutch...
WP_011231421  87 WSG-VRELPWFWKPFAHPMVAIAAAIALPTLLAALLSYLTFKNRIKGVYFSLLSQAVVVVFVTLFIGKQEWTGGTNGL-T 164 Geobacillus kau...
WP_011131591  98 LYG-VDQLPGFWQPFHSPWFTLIAIWLIPALLAALLGNLVFRNRIKGVYFSILTQAALLVFFNFFNGQQKLINGTNGLkT 176 Prochlorococcus...
WP_003894360  97 IAG-VRELPGYWTPFASPVFTLLAILVIPAGIAALLGLGVFKRRVKGAYFAILSQALAAALAILLVG-QTSLGGSNGL-N 173 Mycobacterium s...
WP_010982630 101 LYGtATELPWWWRPFANPVFALAATVLLPMAVAAVLGSFIFRRRVKGAYFAILSQALAAAFAIWLVGQQATTGGTNGL-T 179 Streptomyces av...
WP_011569690 184 DLRTLNGWDIRTDEAKELLYFVNGILLFACLFIAQFVRKSKLGRLLIAMRDQEDRVRFSGYDVASFKIFIFCLGAAFAGI 263 Roseobacter den...
WP_011481529 183 DLKTILGWDTRTDSAKYILYFVTAGLLLGAIVLCTWIQKSKLGTLLLAMRDKEDRVRFSGYDVAMFRVFAFCFAAMLSAV 262 Polaromonas sp....
WP_011321040 173 DFTTLFGATVSDPKTKFIFYTLTVLFLAATYGICRWLTSGRFGRLLIAIRDDESRVRFSGYDPTDFKTLVFAVSGAIAGI 252 Anabaena variab...
WP_010896431 174 GFSTIFGYSLSSASTQQVLYYLTLGCLILVFLLCAALVNSRFGRALVAIRDGENRLRFSGYDTSMFKVAIFTLSAGIAGL 253 Bacillus halodu...
WP_011365538 181 STTEIFGLQAGSDDAQLLFYRITLILLPFAFLLCKYLTSGRFGDALIGIRDDEPRLRFSGFNPTPFKVIVFVVAGGLAGV 260 Synechococcus s...
WP_011584644 178 GFKTLLGFSLSSPSTKLGLYIVSFLVMFGLFLFCKWLVNSKFGKVLVAIRDSESRVSYTAYNVVNYKLAVFVIAAVVAAI 257 Cytophaga hutch...
WP_011231421 165 NFSTVFGFSLSSPLTQIVLYWLTTACLALIFVAARRLTSGRLGKVLIAIRDAENRVRFLGFNPTVYKVFVYSLSAAFAGV 244 Geobacillus kau...
WP_011131591 177 DVTELFGQQVGSAFMQRGFFWLTAVMVILAWLAVRWVVRGRFGEVLIAIRDDEPRLRFAGYNPTLFKTIVFAMAGGLAGI 256 Prochlorococcus...
WP_003894360 174 NFRTFFGFTLNDPVNKRMLYFIAAATLLIVVAVVRQLMYSRYGELLVAVRDGEERVRFLGYDPANIKVVAYTLAALFASI 253 Mycobacterium s...
WP_010982630 180 DIQGFFGYDLDDPVNQRMVYFVIAAALLLLIALARQLIHSRYGELLVAVRDSEERVRFLGYNPANVKLVAYVVAAGMAGL 259 Streptomyces av...
WP_011569690 264 GGAMFTLQVGFMSPTLVGIVPSIEMVIFCAVGGRLSIIGAVYGALLVNWAKTSLSETFPELWLLGLGGLFIAVVMLFPNG 343 Roseobacter den...
WP_011481529 263 GGAMFTLQVGFMSPSLVGIVPSIEMVIFAAVGGRMSLVGAVYGALLVNFGKTYFSESFPDLWLFLMAAMFLGVVLAFPDG 342 Polaromonas sp....
WP_011321040 253 AGAFYTLQSGSVSPRAMDIAFSIEMVIWVAVGGRATLIGAVLGTLLVNYARAFLSEQFAEIWLFFQGALFLIVVTVLPDG 332 Anabaena variab...
WP_010896431 254 AGMLYVLQVGMITPSMIGIIPSIEMILWVAIGGRGTLIGPVIGALVTNSAKTFFSESHPEAWLYLLGTVFVVIVLFLPGG 333 Bacillus halodu...
WP_011365538 261 SGALYTVQSGIVSPQFMSISMSIEMVIWVAVGGRGTLVGPILGAVIVNYLRSLVSEALPEAWLFVQGALFVFVVVLMPDG 340 Synechococcus s...
WP_011584644 258 GGMLYVPQTGIITPGRMDVKASVEMVMWVALGGRGRLKGAIIGALLVNYLYSVCTSMFPESWLYILGVLFILTVLFFEKG 337 Cytophaga hutch...
WP_011231421 245 AGALFVLQVGLISPEMMGIIPSIEMVLWAAVGGRQSLMGAIIGAIVMNTAKSFLSENYPDLWLLLLGALFVVVVLLVPKG 324 Geobacillus kau...
WP_011131591 257 GGALYTVQSGIVSPQYMTVPFSIDMVIWVAVGGRGTLIGAILGALVINLARSQISTVWPEGWLFILGGLFILVVTALPEG 336 Prochlorococcus...
WP_003894360 254 AGALFTPIVGFIAPSQVGIIPSIAFLIGVAIGGRTTLLGPVLGAIGVAWAQTLFSERFPSEWTYAQGLLFIVVVGFFPAG 333 Mycobacterium s...
WP_010982630 260 AGALFVPAVGIISPALIGIVPSIELVIGAAVGGRASLAGAVLGAIAVAWAKTALSEEFPAAWTYFQGLLFIVALAFLPGG 339 Streptomyces av...
WP_011569690 344 LAGV 347 Roseobacter denitrificans
WP_011481529 343 LAGV 346 Polaromonas sp. JS666
WP_011321040 333 LVGW 336 Anabaena variabilis
WP_010896431 334 IMSL 337 Bacillus halodurans
WP_011365538 341 IYGW 344 Synechococcus sp. CC9605
WP_011584644 338 FWGL 341 Cytophaga hutchinsonii
WP_011231421 325 LAGI 328 Geobacillus kaustophilus
WP_011131591 337 VVGW 340 Prochlorococcus marinus
WP_003894360 334 IAGL 337 Mycobacterium smegmatis
WP_010982630 340 LASL 343 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap