Conserved Protein Domain Family
urea_ABC_UrtA

?
TIGR03407: urea_ABC_UrtA 
urea ABC transporter, urea binding protein
Members of this protein family are ABC transporter substrate-binding proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Members of this protein family tend to have the twin-arginine signal for Sec-independent transport across the plasma membrane. [Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 132448
View PSSM: TIGR03407
Aligned: 16 rows
Threshold Bit Score: 626.684
Threshold Setting Gi: 489700191
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011482341  32 IKVGILHSLSGTMAISETVLKDTVLMAIDEINAKGGVM--GK--K--LEPVIVDPASNWPLFAEKTKQLLGQDKVSVIFG 105 Polaromonas sp....
WP_015375024  61 VKVGILHSLSGTMAISEVSLRDAELMAIEEINASGGLL--GK--K--IEPVVEDGASDWPTFAEKAKKLLQKDQVAAIFG 134 Geobacillus
WP_011430744  42 IRVGILHSLSGTMAISETSVVDAEKLAIKEINAAGGVL--GK--Q--IEPIIEDGASDWPTFAEKATKLIDVDKVATVFG 115 Synechococcus s...
WP_010896433  46 IAVGILHSLSGTMAMSETSVRDAELLAIEEINEAGGVL--GK--E--LVPIIEDGASEPNIFAERATKLLQQDEVAVIFG 119 Bacillus halodu...
WP_010982628  66 VKVGLLNSLSGTMAISEVTVRDSLKLAIDEINASGGVL--GK--K--IKPISEDGASDWPTFAEKASKLIKEDRVAATFG 139 Streptomyces av...
WP_006770035  46 VKVGFINSLSGTMAISETTVNESLHMAAQEINADGGVL--GK--E--LVIAEEDGASEPATFAERAQRLIQQECVAAAFG 119 Corynebacterium...
WP_011728738  53 IKVGSLNSLSGTMAISEVTVRDAIKLAVEEINADGGVL--GK--Q--IELIGEDGASEPTVFAEKAEKLISSDCVAAVFG 126 Mycobacterium s...
WP_011620759  68 VTVGILHSLTGTMAISESTLVDTEKMAIDEINAAGGVEvdGK--KykIEYIVEDGASDWPTFAEKSKKLIDQDKVPVVFG 145 Synechococcus s...
WP_011365540  40 IKVGILHSLSGTMAISETTLKEVEEMAIKEINDAGGVKidDKsyK--ITYVSEDGASDWPTFAEKSQKLIDADKVAVVFG 117 Synechococcus s...
WP_011589264  54 VKVGILHSVTGTMAISETGSVQAEKLAIEQINASGGVL--GR--Q--IEYIQEDGASDWPTFAEKSRKLLVNDNVAAVFG 127 Alcanivorax bor...
WP_011482341 106 CWTSVSRKSVLPVVEEMNGLLFYPVQYEGEELSKNVFYTGAAPNQQAIPAVDYLMSKa-gGGaKRWVLLGTDYVYPRTTN 184 Polaromonas sp....
WP_015375024 135 GWTSASRKAMLPVVEQNNGLLWYPVQYEGMESSPNIFYTGATTNQQIVPAVSWLLKN---RG-KTFFLLGSDYVFPRTAN 210 Geobacillus
WP_011430744 116 CWTSASRKAVLPVFESKQHLLWYPVQYEGQECSKNIFYTGAAPNQQIEPSVEWLLKN---KG-KEFFLVGSDYVFPRTAN 191 Synechococcus s...
WP_010896433 120 GWTSASRKAMLPVVEENNGLLFYPVQYEGMEASPNIFYAGAAPNQQIVPAVEWLLEN---RG-TEFFLLGSDYVFPRLAN 195 Bacillus halodu...
WP_010982628 140 CWTSASRKAVKPVFEKNKSLLFYPVQYEGLEESPYIFYTGATTNQQIVPALDYLKSQ----GkKKIYLVGSDYVFPRTAN 215 Streptomyces av...
WP_006770035 120 GWTSASRKAMLPVFEGNNSLLFYPVQYEGMESSPNIFYTGATTNQQIIPALDYLKEQ----GkSRLFLVGSDYVFPRTAN 195 Corynebacterium...
WP_011728738 127 GWTSSSRKAMLPVFESANALLYYPVQYEGLESSPNIFYTGATTNQQIVPALDYLKEK----GvKSLYLVGSDYVFPQTAN 202 Mycobacterium s...
WP_011620759 146 GWTSASRKAMLPVYESKEAFLYYPIQYEGQECSKNIFYTGATPNQQSEPATSYMFEKs-pAAgKPFYLVGSDYVFPRTSN 224 Synechococcus s...
WP_011365540 118 GWTSASRKAMLPVYEAKDHFLFYPIQYEGQECSKNIFYTGAVPNQQAEPAVDWLFEKfaeKYgKKVYLVGSDYVYPRTAN 197 Synechococcus s...
WP_011589264 128 CWTSASRKAVLPVFEQYNGMLYYPTFYEGLEKSPNVIYTGQEATQQILASIDWLAEE---KGaKTFYLLGSDYIWPRTSN 204 Alcanivorax bor...
WP_011482341 185 KILRAYLKSKGvkDTDIDEKYTPFGHSDYQTIVADVKKFSA--GgktAVVSTINGDSNVPFYKELGNAGLKAKD-VP-VV 260 Polaromonas sp....
WP_015375024 211 KIIKAQLKAEG--GQVVGEEYTPLGHTDYSTIISKIKQVKP--A---VVFNTLNGDSNVAFFKQLKDAGITPKD-VT-VM 281 Geobacillus
WP_011430744 192 TIIKAQLEALG--GKVVGEDYLPLGSTEVTPIISKIRAALPngG---VIYNSLNGDSNVAFFKQLEGAGLGPDR-YP-SM 264 Synechococcus s...
WP_010896433 196 AIIKAQLESHG--ATLVDEQYTPLGHTDYNTIISRIRESEP--T---VIFNTLNGDSNVAFFKQLADAGITADD-VT-VM 266 Bacillus halodu...
WP_010982628 216 KIIKAYAKANG--MTVLGEDYAPLGSTEFSTIANKVKAAKA--D---AVFNTLNGDSNVAFFKEYKSAGLTAKS-MP-VV 286 Streptomyces av...
WP_006770035 196 QIIRDYAEANG--MEIVGEDYTPLGSTDFTTIANRMKNSGA--D---AVFNTLNGDSNVAFFRQYNSLGLTAET-LP-VM 266 Corynebacterium...
WP_011728738 203 RIIKAYAEANG--IEIKGEDYTPLGSTDFSTIVNKVRSANA--D---AVFNTLNGDSNVAFFREYRNVGLTPDT-MP-VV 273 Mycobacterium s...
WP_011620759 225 TITKEQVKSLG--GEVVGEDYLPLGNTEVAPIIAKIKAALP--Dg-gVIINTLNGDQNVAFFKQIQDAGITPENgYY-VM 298 Synechococcus s...
WP_011365540 198 TIIKEQVKSLG--GVTVGEDYIPLGNTEVAPIIAKIKKEFP--Dg-gIIINTLNGDSNVALFKQFKAAGITPDK-YP-IM 270 Synechococcus s...
WP_011589264 205 KIARKHIDKLG--LKVVGEEYYPLGHTQFNSVINKIKLKKP--D---VIFASVVGGSNVAFYKQMKAAGIDLTKeSPlLL 277 Alcanivorax bor...
WP_011482341 261 AFSVGEEELRGVDTKPLVGHLAAWNYFQSIKSPANTEFIKKWSD-YakaKGiaghkDKPLTNDPMEATYIGINMWKQAVE 339 Polaromonas sp....
WP_015375024 282 SVSIAEEEIRGIGPDVLAGHLAVWNYFQTTDTPENKAFVQKYKE-K---YG-----QDRVTDDPIEAAYTAVHLWAEAVK 352 Geobacillus
WP_011430744 265 SVSIAEEEVQAIGPEFLEGHFAAWNYFMTVDTPANKKFVEAFKA-E---YG-----QNRVTNDPMEAAYIMVYIWKQAVE 335 Synechococcus s...
WP_010896433 267 SVSVAEEEIRGIGADVLAGHLASWNYFQTTDTPENDTFVTAYIK-S---FG-----DDRVTGDPIEAGYLMVHLWAQAVE 337 Bacillus halodu...
WP_010982628 287 SVSIAEEEVKSIGSQYLAGQLTAWNYYQTTPGAANTKFVKAYKA-K---YG-----QGKPTSDPMEAAYTSVYLWKAMVE 357 Streptomyces av...
WP_006770035 267 SVSIAEEEIAGIGASNIEGQLVAWNYYQTVDTDENAGFVDRFKS-L---YG-----QDRVTSDPMQAAYTSLYLWKEMVE 337 Corynebacterium...
WP_011728738 274 SVSIAEEEVGGIGVQNIDGQLTAWNYYETIDTPENKAFVKAYKDfV---KD-----PKKPTSDPMEAAYVSVYLWKNTVE 345 Mycobacterium s...
WP_011620759 299 SYSIAEEEISTIGPEFLEGHYGAWNYMMSIDTPASKKFAADFKA-K---YG-----DDRVVADPQESAYNMVYLWKKAVE 369 Synechococcus s...
WP_011365540 271 SFSIAEEEIRQIGPDYVGGTYAAWNYFMSLGTEASNTFNEAFID-M---YG-----DDRVTNDPMESAYNMVYLWKAAVE 341 Synechococcus s...
WP_011589264 278 TISVTEDEILGIGGENVEGAYASMKYFQSLGNDNNQDFVKAFKK-R---WG-----EDIVIGDVTQAAYLGPWLWKAAVE 348 Alcanivorax bor...
WP_011482341 340 KAKST-DTDKVIAAMAGQTF-KAPSGIVsKMDEKNHHLHKSVFIGEIKADGQFNVVWKTPGPVKAKPWS 406 Polaromonas sp. JS666
WP_015375024 353 KAGSF-DVDQVKKAAAGLEY-KAPEGTV-KIDGETQHLWKTVRIGEIQADGQFKELWNSGQPVKPDPYL 418 Geobacillus
WP_011430744 336 KAGTV-EIDAVRQAAYGQTF-DAPEGLV-TMNT-NHHLTKYVRIGQVRSDGLFDVIFSTD-AVEPQPWN 399 Synechococcus sp. JA-3-3Ab
WP_010896433 338 AAGTT-DIEAVREAASTIEF-SAPGGLV-KVDGDNQHLYKTVRIGEVQADGQFEEVWNSGEPVKPDPFL 403 Bacillus halodurans
WP_010982628 358 KAKSF-DPEKVKAASDGITF-DAPEGKV-TVDGASQHIRKTARIGRIGTDGLIEQVWDSGKPIKPDPFL 423 Streptomyces avermitilis
WP_006770035 338 KAGSF-ETEAIRQAADGTSF-DAPEGTV-VVDGDNNHISKTPRIGQVREDGLIDIIWETDSPVNPDPFL 403 Corynebacterium efficiens
WP_011728738 346 KAQSF-DVKAIQDNADGVSF-DAPEGKV-TIDGENHHITKTARIGEIRPDGLIYTVWESKGPIEPDPYL 411 Mycobacterium smegmatis
WP_011620759 370 KAGTF-DDDKVREALIGIKF-DAPQGPI-EVRP-NHHISQIVRIGEITSDGQFKIVEESDYPIDPQTWN 434 Synechococcus sp. CC9311
WP_011365540 342 KAGTYeDLDAVRDTLIGIKL-DAPQGPI-EMYP-NHHISQTVRIGEAKADGQFEILWDSIDPVAPITWN 407 Synechococcus sp. CC9605
WP_011589264 349 KAGSF-DIDKVREASPGIELtTAPEGYV-RIHE-NHHLWSKARIGQAQKDGQYKVIYETEELMEPDPFP 414 Alcanivorax borkumensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap