Conserved Protein Domain Family
nifS_epsilon

?
TIGR03403: nifS_epsilon 
cysteine desulfurase, NifS family, epsilon proteobacteria type
Members of this family are the NifS-like cysteine desulfurase of the epsilon division of the Proteobacteria, similar to the NifS protein of nitrogen-fixing bacteria. Like NifS, and unlike IscS, this protein is found as part of a system of just two proteins, a cysteine desulfurase and a scaffold, for iron-sulfur cluster biosynthesis. This protein is called NifS by Olsen, et al. (), so we use this designation.
Statistics
?
PSSM-Id: 132444
View PSSM: TIGR03403
Aligned: 5 rows
Threshold Bit Score: 757.849
Threshold Setting Gi: 488956064
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011139978   8 VYLDNNATTLVDPKVKELMDPYFCQMYGNPNSLHRFGTETHPAIKKALDDLYEGINAADEDDVIITSCATESNNWVIKGV 87  Wolinella succi...
WP_011115406   4 VYLDNNATTMLDPSIKPLMEPYFCEKFGNPNSLHKYGTQTHAAISEAIEKLYKGINADDNDDIIITSCATESNNWVIKGV 83  Helicobacter he...
WP_000941691   5 IYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGV 84  Helicobacter py...
WP_011373622   3 VYLDNNATTMVDPLVVEEMMPFFSDIYGNPNSLHKFGTASHPAIAKAIDRVYKAVNARDSDDIVFTSCATESNNWVLKSI 82  Sulfurimonas de...
WP_002867139   3 VYLDNNATTMLDPNAYELMLPFLKDIYGNPNSLHQYGSATHPALREALDKLYAGLGANDLDDIVITSCATESINWVLKGV 82  Campylobacter j...
WP_011139978  88 YFDILRHGVKNHIVTTDVEHPAVRATCAFLETLGVEVTYLPINDQGTISAEQVREAITEKTALVSVMWANNETGMIFPIQ 167 Wolinella succi...
WP_011115406  84 YFDEIVKKGKRHIITTEVEHPAVRATCAFLETLGVEVTYLPINQQGTITAKQVRESLREDTALVSVMWANNETGLIFPIE 163 Helicobacter he...
WP_000941691  85 YFDECLKKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIE 164 Helicobacter py...
WP_011373622  83 YRDYIVNGDKNHIITTEVEHPSVYSACKALEEDGVKVTYLPVNSQGIVEAHVVKSFITDKTALVSIMWASNETGMINPIK 162 Sulfurimonas de...
WP_002867139  83 YFDHILDRERNEVIISSVEHPAVAAAAYFLKSLGVKVIELPVNEEGVSTVEDLRKVISDKTALVSVMWANNETGMIFDIK 162 Campylobacter j...
WP_011139978 168 EIGEICRERGILFHTDAVQAIGKIPVDVQKAKIDLLSFSAHKFHGPKGMGALYIRKGVELTPLFHGGEHMSGRRSGTLNV 247 Wolinella succi...
WP_011115406 164 EIGTLCRQNNVLFHTDAVQAIGKIPVDVQSAQVDFLSFSAHKFHGPKGVGGLYIRKGIELTPLFHGGEHMRGRRSGTLNV 243 Helicobacter he...
WP_000941691 165 EIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNV 244 Helicobacter py...
WP_011373622 163 EIGEICKERGVLFHSDAVQAVGKIPVDLQDIHVDFLSMSAHKFHGPKGIGALYIKNSQPLSPLLNGGEHMGGRRSGTLNV 242 Sulfurimonas de...
WP_002867139 163 AMAELAHEFGALFHTDATQAVGKIKVNLTQVGVDFASFSAHKFHGPKGVGGLFIKKGLKLTPLLHGGEHMGGRRSGTLNV 242 Campylobacter j...
WP_011139978 248 AGIVGMGEAMRLAVQYLDFEKSNVRRLRDRLENALLELPDVFVVGSRENRVPNTVLISVKGVEGEAMLWDLNKAGIAAST 327 Wolinella succi...
WP_011115406 244 PYIIAMGEAMKLANDYLDFELSQVKNLRDRLESALLEIPDVFVVGTRDNRVPNTTLISIRGIEGEAMLWDLNKAGIAAST 323 Helicobacter he...
WP_000941691 245 PYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVPNTTLVSVRGIEGEAMLWDLNRSNIAAST 324 Helicobacter py...
WP_011373622 243 PYIVAMGKAIELATENIEEKMASIRAKRDRLEDALLELSDTFVIGDREHRTPNTILISIKGVEGEGMLWDLNNGQIGAST 322 Sulfurimonas de...
WP_002867139 243 PYIVAMGEALRIANTMLDFEDSHIRRLRDKLEDQILALPDTTVVGKREHRVPNTILASIKGVEGEAMLWDLNKNGIAAST 322 Campylobacter j...
WP_011139978 328 GSACASEDLEANPVMIAIGADKELAHTAIRLSLSRFTTEAEIDYTIEVFKKSAERLRSISSS 389 Wolinella succinogenes
WP_011115406 324 GSACASEDLEANPVMVAIGADKELAHTAIRISLSRFTTSEEIDYTIEVFKKAVQRLRAISSS 385 Helicobacter hepaticus
WP_000941691 325 GSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSS 386 Helicobacter pylori
WP_011373622 323 GSACASEDLQANTVMLAIGADNELAHTGIRLSLSRFTTDSEIDYAITHFKKSVERLRAISSS 384 Sulfurimonas denitrificans
WP_002867139 323 GSACASEALESNPIMEAIGAEHDLAHTALRLSLSRFNTEEEIDYAAKQIKNATQRLRAISCT 384 Campylobacter jejuni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap