Conserved Protein Domain Family
FeS_nifS

?
TIGR03402: FeS_nifS 
cysteine desulfurase NifS
Members of this protein family are NifS, one of several related families of cysteine desulfurase involved in iron-sulfur (FeS) cluster biosynthesis. NifS is part of the NIF system, usually associated with other nif genes involved in nitrogenase expression and nitrogen fixation. The protein family is given a fairly broad interpretation here. It includes a clade nearly always found in extended nitrogen fixation genomic regions, plus a second clade more closely related to the first than to IscS and also part of NifS-like/NifU-like systems. This model does not extend to a more distantly clade found in the epsilon proteobacteria such as Helicobacter pylori, also named NifS in the literature, built instead in TIGR03403.
Statistics
?
PSSM-Id: 132443
View PSSM: TIGR03402
Aligned: 28 rows
Threshold Bit Score: 627.333
Threshold Setting Gi: 499560783
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P05341         4 VYLDNNATTRVDDEIVQAMLPFFT-EQFGNPSS-LHSFGNQVGMALKKARQSVQKLLGA-EhDSEILFTSCGTESDSTAI 80  Azotobacter vin...
WP_003473085   6 VYMDYSATTYVKPEVLEEMLPYFT-NKFGNPSA-FYGVSRESRMAVDTARERVAKVLNA-D-TNEIYFTGGGSEADNWAI 81  Clostridium per...
WP_011026486   4 IYLDNAATTPVDKRVLEAMLPYYS-DVFGNPSS-LYSYGQEAKKAIEEAREKVAKALGA-D-SDEIYFTSGGSESDNWAL 79  Caldanaerobacte...
WP_011986887   5 VYMDYSATTYTKPEVLEEMLPFFT-ENFGNPSS-LYSFSDKTKKAVNLARERVSKALNA-E-KNEIFFTSGGSEADNWAI 80  Clostridium bot...
WP_011345085   4 IYLDHGATTPLSREVLEEMLPYLT-EKFGNPSS-IHAFGREARKAIEDAREKVAKAINAsD-PGEIVFTGGGTEADNLAI 80  Carboxydothermu...
WP_011307390  18 IYMDNSATTPIRKEVVEEMLPYMT-ENFGNPSS-IYEIGKISKHAIDKARVKVANALGA-E-ENEIYFTSGGTESDNWAI 93  Methanosarcina ...
WP_011449176   7 IYMDHSATTATDSAVVEAMLPWFS-INYGNPSS-LYRLARESKAAIEDARKKVANAIGA-K-SEEIYFTSGGTESDNWAL 82  Methanospirillu...
WP_011393154   4 VYLDHSATTPVRPEVLEAMLPFLKdEAFGNPST-VYSYGREAKKALEEAREKVANLIGA-R-PEEIFFTSGGTEADNLAL 80  Moorella thermo...
WP_011099295   6 VYMDYSATTYTKPEVLEEMLPYFT-GKFGNPSSkFYSVSQDPIEAIDSARERVAKGINS-E-KDEIYFTSGGSEADNWAI 82  Clostridium tetani
WP_011023198  58 IYMDHAATTFTKPEVIEAMLPFLK-EHFGNPSS-LYSIGREGKEAVETSRKKLAKALGA-AqPEEIYFTSGGTESDNWAI 134 Methanosarcina ...
P05341        81 LSALKAQPER-KTVITTVVEHPAVLSLCDYLASEGYTVHKLPVDKKGRLDLEHYASLLTDDVAVVSVMWANNETGTLFPI 159 Azotobacter vin...
WP_003473085  82 KGIAFAHKNKgNHIITTKIEHHAVLHTCQWLEKQGFEVTYLDVNEEGFVDLEELKNAITDKTILVSVMFANNEIGTIEPV 161 Clostridium per...
WP_011026486  80 KGVAYALKDKgNHIITTEIEHHAVLNTCRYLEKEGFKVTYLPVDEYGLVKPEDLKKAITDKTILVSIMFANNEIGTIEPI 159 Caldanaerobacte...
WP_011986887  81 KGIAYANKKKgNHIITTKIEHHAILHTAQFLEKEGFKVTYLPVDEEGFVSVEDIKNAITDETILVSVMFANNEIGTIEPI 160 Clostridium bot...
WP_011345085  81 KGIARAYKHKgNHIITSAVEHHAVLDACLALQKEGFEVTVLPVDKYGMVSVEDVKKAITDKTILITIMHANNEVGTIQPI 160 Carboxydothermu...
WP_011307390  94 KGIAFANRNKgKHIITSSIEHHAVLHTCAWLEGQGFEVTYLPVDKYGMVSPEEVKKAIRDDTILISIMLANNEIGTIQPV 173 Methanosarcina ...
WP_011449176  83 KGTAFALQKKgNHIITSAIEHHAILHTCQYLEKHGFQVTYLPVDEFGQVRIEDLRAAITDKTILVSVMFANNEIGTIQPI 162 Methanospirillu...
WP_011393154  81 IGTAAANEKKgRHIITSSIEHHAVLHTAQYLLRHGFKVTFLPVTPEGLVRVEDVEKAITDETILISVMHVNNEVGTIQPI 160 Moorella thermo...
WP_011099295  83 KGVAFANKNKgNHIITTAIEHHAVLHSCEFLKRNGFEITYLPVNDEGLISLEDLKNAIKDNTILVTIMFANNEIGAIQSI 162 Clostridium tetani
WP_011023198 135 KGTAFSRQKKgKHIITTPIEHHAVLYPCEYLETQGFEVTYLPVDEYGLVNPAEVEASIKKDTVLISVMYANNEIGTIEPI 214 Methanosarcina ...
P05341       160 EEMARLADDAGIMFHTDAVQAVGKVPIDLKN--SSIHMLSLCGHKLHAPKGVGVLYLRRGTRFRPLLRGGHQERGRRAGT 237 Azotobacter vin...
WP_003473085 162 KEIGKICRERKVIFHTDAVQAVGNVKIDVKD--MNIDLLSLAGHKVYGPKGIGALYIRKGIRIDNLIHGGGQERARRAGT 239 Clostridium per...
WP_011026486 160 EELVKIAHEKNVYFHTDAVQAVGNVPIDVKK--LDVDLLSLSAHKIYGPKGVGALYIKKGVKIHSLIQGGTQERNRRAGT 237 Caldanaerobacte...
WP_011986887 161 KEIGELCKEKNIYFHTDAVQAIGHVDIDVKD--MNIDLLSMSAHKFYGPKGVGALYIKNGVKIQNLIHGGGQERGKRAST 238 Clostridium bot...
WP_011345085 161 AEIGEIAREKGVYFHTDAVQTVGKIPVDVKE--LKVDLLSLSAHKIYGPKGVGALYVRKGLKLEPLANGGGQERKRRPGT 238 Carboxydothermu...
WP_011307390 174 EEIGKITKENRIYFHTDAVQAIGHIPIDVKK--MNIDLLSLSGHKFEGPKGCGALYIRKGTKIDTLLHGGAQERKRRAGT 251 Methanosarcina ...
WP_011449176 163 PEIGAFCRERGILFHTDAVQVIGNLPVDVAA--MNIDLLSLSAHKFYGPKGIGALYIRKGVRIDNYLHGGGQEHRKRAGT 240 Methanospirillu...
WP_011393154 161 KEIGKLARERGIIFHTDAVQSVGKLPVNVDE--LGVDLLSASGHKIYGPKGIGCLYIRKGTKINPILYGGAQERKRRPGT 238 Moorella thermo...
WP_011099295 163 KEIGKICRERKVLFHTDAVQAMGHVPIDVKD--MNIDMLSMAGHKFYGPKGIGALYIRKGVRIENLIHGGGQEKGKRGTT 240 Clostridium tetani
WP_011023198 215 LEIGKIAREHGIPFHTDAVQVIGKVPLDLQRehKDVDMLSLSSHKFYGPKGIGALYIREGTEIDNYMHGGAQERGKRAGT 294 Methanosarcina ...
P05341       238 ENAASIIGLGVAAERALQFMEHENTEVNALRDKLEAGILAVVPHAFVTGDP-D--N--RLPNTANIAFEYIEGEAILLLL 312 Azotobacter vin...
WP_003473085 240 ENIPAIVGLGKAMEIAGENLDEHIAKISKLRDKLIKGLLE-VPFTRLNGPK-DgsK--RLPGNVNVCFEFIEGEGILLSL 315 Clostridium per...
WP_011026486 238 ENVPGIVGLGEAMELITKNLDSHINKLTFLRDKLINGILEKIPYARLNGHP-T--K--RLPGNVNVSFEFIDGESLILNL 312 Caldanaerobacte...
WP_011986887 239 ENTAGIVGLGKAIELAMENMPEENEKLSNLRGRLIRGIEARIPEVKLNGPK-D--MsrRLPNNVNFSFIGIEGETLLLDL 315 Clostridium bot...
WP_011345085 239 ENVAGIVGLGKAIELAVAEMPEESARLTKLRDKLIKGVLERIPYVRLNGHP-T--K--RLPHNANFSVEFVEGESMLLML 313 Carboxydothermu...
WP_011307390 252 ENVPAIVGLGKAIELATAKIEESNKNLLELREHFIRGLL-KIPKTHLNGHP-T--Q--RLANNVNVTFEYIEGESLLLLL 325 Methanosarcina ...
WP_011449176 241 ENVPGIVGLGVAIQKAVMDLDVKTSRIRALRDTLLDRILHEIPNTRLNGHR-T--M--RLPGNLNVSFEFIEGESLLLLL 315 Methanospirillu...
WP_011393154 239 ENMPGIVGFGRAAELAGQELESEMERLQALRDKLIDGILTRIEDVQLNGDP-R--Q--RVATNANFSFRYCEGESILLSL 313 Moorella thermo...
WP_011099295 241 ENVPGIVGIGKAIELATEHLYEEKERLTKMRDRLIEGLMNKIPHTKLNGPTgD--K--RLPNNVNLSFIGIEGETLLLDL 316 Clostridium tetani
WP_011023198 295 ENVVGIVGMGKAIELATANIEAHNEKLSKMRARLMAGILE-IPYCRLNGHP-E--K--RLPGNLNFSFEYIEGESLLLML 368 Methanosarcina ...
P05341       313 NKVGIAASSGSACTSGSLEPSHVMRAMDIPYTAAHGTVRFSLSRYTTEEEIDRVIREVPPIVAQLRNVSPY 383 Azotobacter vinelandii
WP_003473085 316 DFEGICGSSGSACTSGSLDPSHVLLAIGLPHEIAHGSLRLSLGEGTTEEDVDYVLEKVPPIIARLRSMSPL 386 Clostridium perfringens
WP_011026486 313 DMAGICASSGSACTSGSLEPSHVLLAIGLPRELARGSLRLTIGKENTEEDIDKVLEVLPQIIKRLRSISQI 383 Caldanaerobacter subterr...
WP_011986887 316 DMNGIFGSTGSACASASLDPSHVLLSIGLPHETAHGSLRLSLGAKNTEEDIDYVLEVLPKIIKQRREMSPL 386 Clostridium botulinum
WP_011345085 314 DMKGIAASSGSACTSGSLDPSHVLLAMGIPHEVAHGSLRLTLGKANTEEQIDYVLEVLPGIVERLREMSPL 384 Carboxydothermus hydroge...
WP_011307390 326 NANGIFASTGSACNSSSLEPSHVLTACGVPHEIVHGSLRLSLGRTNSKKDVDRVLEVLPEIVQKLRNMSPL 396 Methanosarcina barkeri
WP_011449176 316 DHAGIAASTGSACSSGSLEPSHVLLAIGLPAEVAHGSLRLTLGVQNTEEDVSYACDEIKKAVERLRAMSPL 386 Methanospirillum hungatei
WP_011393154 314 DMKGICASSGSACTSGSLDPSHVLLAMGIPHEVAHGSVRMTLGRENTEEDIDYVLEVMPEIIARLRSMSPL 384 Moorella thermoacetica
WP_011099295 317 DFEGVCASTGSACASGSLDPSHVLLSIGLSHGIAHGSLRLTLGEGSTEEDVDYILNTLPDIVKRRREMSPY 387 Clostridium tetani
WP_011023198 369 DQMGICCSTGSACSSGSSEPSHVLRAIGLAPKTAQGTLRLTLGDANSEEDIDYVLEVLPEVVGKLRAISPF 439 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap