Conserved Protein Domain Family
plc_access_R

?
TIGR03398: plc_access_R 
phospholipase C accessory protein PlcR
The class of microbial phosphocholine-preferring phospholipase C enzymes described by model TIGR03396 has two members in Pseudomonas aeruginosa, one of which (PlcH) is hemolytic and can hydrolyzes sphingomyelin as well as phosphatidylcholine. This model describes PlcR, an accessory protein for PlcH with which it forms a heterodimer. The member of the family from P. aeruginosa, although not the members from various Burkholderia species, is encoded immediately downstream of phospholipase C.
Statistics
?
PSSM-Id: 132439
View PSSM: TIGR03398
Aligned: 4 rows
Threshold Bit Score: 168.168
Threshold Setting Gi: 497666083
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011353917  58 FRAQLDGYAHERDALNAADRQARARSLLAQLRADADAGKLDPREASGLADLLLQDAEPDAGARQAASDALRDHLRDLA-M 136 Burkholderia lata
WP_011356595  97 FRDEVAAYGDRRNSMPQAERAALARRILDELPDHVARNEIVPVQAEALSAALLTDTEADPATRSAAIRSMRAQWDAYS-Q 175 Burkholderia lata
WP_016851926  66 LEQQLGEFGRNAGQMSEIERKQAAEGLIEQLKREVAVGA-DPRQTFEEIQRLTPYVEADARRREALDFEIWMALKDNAsV 144 Pseudomonas aer...
WP_009980267  83 FRDRIAAYGEGRNSMPAEERARLAREILAELPEHVARNEIVPVQAEALSAALLADATSDSRTRDAAIQSMRQQWDAYA-G 161 Burkholderia ps...
WP_011353917 137 GERPASPARERQDADYVAQSRKIIDEVVRTVPDREQQRVALDTRLAELRRQIYGTDAPVTHG 198 Burkholderia lata
WP_011356595 176 QTVGPSPAQDPRYLSYEQQSRDVVRQVQASIPDPDQQQAVIAQRLQALRVQLFDGASPSGVH 237 Burkholderia lata
WP_016851926 145 QQQAPTPGEEEQLREYAQESDKVIAEVLASVDDEEQRHAAIDERLKALRKQIFGEENPRLLQ 206 Pseudomonas aeruginosa
WP_009980267 162 RTVGPSPASDPRYLAYARQSRDIVAQVQASVPDPDQQQAVIAQRLQALRVQLFDQASRSDTR 223 Burkholderia pseudomallei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap