1ZWX,2DDR


Conserved Protein Domain Family
sphingomy

?
TIGR03395: sphingomy 
Click on image for an interactive view with Cn3D
sphingomyelin phosphodiesterase
Members of this family are bacterial proteins that act as sphingomyelin phosphodiesterase (EC 3.1.4.12), also called sphingomyelinase. Some members of this family have been shown to act as hemolysins. [Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 132436
View PSSM: TIGR03395
Aligned: 7 rows
Threshold Bit Score: 488.589
Threshold Setting Gi: 99032047
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ZWX_A  11 FKITSHNVYLFSRNI--YPNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGRSK-HGWD 87  Listeria ivanovii
Q72P44 123 IKILSHSIFMAPTNLssWGDLGQEERAQRIASSSYIKNQDIIVFEGLSHNNAEKILLEKIRSEYPYQTNVVGRTK-KGWN 201 Leptospira interrogan...
P59116 155 IKVLSHNVFMLPTNLprWGNLGHDERAKRISKSDYVKNQDVIVFEEAFDTSARKILLDNLREEYPYQTDVVGRTK-KNWD 233 Leptospira interrogan...
P17627  86 IKILTHNVFLLPKTLpgWGNWGQNERAQRIVSSNYIQNQDVIVFDEAFDTDARKILLDGVRSEYPYQTDVIGRTK-KGWD 164 Leptospira interrogans
Q9RLV9  45 FKITSHNVYLFSRNI--YPNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTPVIGRSK-HGWD 121 Listeria ivanovii
P09599  37 LKVMTHNVYMLSTNL--YPNWGQSQRADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSNgNEWD 114 Bacillus cereus
2DDR_A  10 LKVMTHNVYMLSTNL--YPNWGQTERADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAVLGRSSgSEWD 87  Bacillus cereus
1ZWX_A  88 KTEGNYSNFALEDGGVAVVSQWPIVEKSQHIFQ-RGGGADRLSNKGFAYVKIMKNGKPYHIIGTHTQADDSLISKDTsRA 166 Listeria ivanovii
Q72P44 202 ATLGAYTTSPMANGGVIIVSKWPIEEKVQYIFNnSNCGQDQYYNKGFAYVKINKDGKKFHVIGTQLQAREPDCFNSG-ET 280 Leptospira interrogan...
P59116 234 ASLGNFRSYSLVNGGVVILSKWPIEEKIQYIFNdSGCGADWFANKGFVYVKINKEGKKFHVIGTHAQSQDQNCSNLG-IP 312 Leptospira interrogan...
P17627 165 ATLGLYRTDAFTNGGVVIVSKWPIEEKIQHVFKeKGCGADVFSNKGFAYVRIDKNGRKFHIIGTHVQAQDSGCANLG-VV 243 Leptospira interrogans
Q9RLV9 122 KTEGNYSNFALEDGGVAVVSQWPIVEKSQHIFQ-RGGGADRLSNKGFAYVKIMKNGKPYHIIGTHTPADDSLISKDTsRA 200 Listeria ivanovii
P09599 115 KTLGSYSSSTPEDGGVAIVSKWPIVEKIQYVFA-KGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQAEDSMCGKTSpAS 193 Bacillus cereus
2DDR_A  88 KTLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFA-KGCGPDNLSNKGFVYTKIKKNDRFVHVIGTHLQAEDSMCGKTSpAS 166 Bacillus cereus
1ZWX_A 167 IRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVNY------GTDEYHDMLKLLNVSSPAnFNGQMATWDPTTNSMLKESYP 240 Listeria ivanovii
Q72P44 281 IRKLQLNDIKSFIDSKDIPKDETVLITGDLNIIK------GSNEYFDMISKLNVNEPR-YVGVPFTLDTKTNALAAYYYE 353 Leptospira interrogan...
P59116 313 NRANQFDDIRNFIYSKNIPKDETVLIVGDLNVIK------ESNEYYDMISRLNVNEPR-YVGVPFTWDAKTNEIAAYYYE 385 Leptospira interrogan...
P17627 244 SRVNQFNEIRDFIDSKKIPKNEMVLIAGDLNVIK------GSREYHQMLCILNVNNPK-YVGVPFTWDTKTNEIAAFYYK 316 Leptospira interrogans
Q9RLV9 201 IRAEQMQEIQTFIAKKNIPKDEIIFIGGDLNVNy------GTDEYHDMFKLLNVSSPAnFNGQMATWDPTTNSMLKESYP 274 Listeria ivanovii
P09599 194 VRTNQLKEIQDFIKNKNIPNDEYVLFGGDMNVNKinaennSDSEYASMFKTLHASIPS-YTGHTATWDATTNSIAKYNFP 272 Bacillus cereus
2DDR_A 167 VRTNQLKEIQDFIKNKNIPNNEYVLIGGDMNVNKinaennNDSEYASMFKTLNASVPS-YTGHTATWDATTNSIAKYNFP 245 Bacillus cereus
1ZWX_A 241 KAAPEYLDYIFVENGHARPHSWHNKVLHTKspqwS----VKSWFKT--YTYQDFSDHYPVVGFT 298 Listeria ivanovii
Q72P44 354 KEKPIYLDYILVSKLHAQPPVWQNLAYDPI----S----NTTWKRSdgYTSYEFSDRYPVYGFI 409 Leptospira interrogans serovar Copenh...
P59116 386 NEEPVYLDYIFVSKSHAQPPVWQNLAYDPV----S----KQTWTVSg-YTSDEFSDHYPIYGFV 440 Leptospira interrogans serovar Lai st...
P17627 317 KVEPAYLDYIFVSKSHFQPPIWQNLAYDPI----S----AKTWTAKg-YTSDEFSDHYPVYGFI 371 Leptospira interrogans
Q9RLV9 275 KAAPEYLDYIFVENGHARPHSWHNKVLHTK----SpqwsVKSWFKT--YTYQDFSDHYPVVGFT 332 Listeria ivanovii
P09599 273 DSPAEYLDYIIASKDHANPSFIENKVLQPK----SpqwtVTSWLKK--YTYDDYSDHYPVAATI 330 Bacillus cereus
2DDR_A 246 DSPAEYLDYIIASKDHANPSYIENKVLQPK----SpqwtVTSWFQK--YTYNDYSDHYPVEATI 303 Bacillus cereus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap