Conserved Protein Domain Family
ascorbOXfungal

?
TIGR03390: ascorbOXfungal 
L-ascorbate oxidase, fungal type
This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
Statistics
?
PSSM-Id: 132431
View PSSM: TIGR03390
Aligned: 5 rows
Threshold Bit Score: 954.673
Threshold Setting Gi: 46110897
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001226708  23 VVHDDQFQPDHILRVAVAQVPSACESRESVVVNGTSPGPAVRLLPGARTWIRVYNDIPDQNLTMHWHGLSQRFAPFADGT 102 Chaetomium glob...
BAA24288      23 VKHDGGFVPDHVLRVSSRNISIACTSRQSAVVNGTSPGPELRVPAGQRTWIRVYNDLEQENLTMHWHGLAQRMAIFADGS 102 Acremonium sp. ...
XP_680658     23 VRHDHSFQPDHILRVTADIYNEACSERYSVLVNGSSPGPELRLREGEVSWIRVYNDMTDANTTIHWHGLTAFTAPFSDGS 102 Aspergillus nid...
XP_681850     20 IRHDGSFQPDHILRVNSKNYMQACSPRYSVLVNGSFPGPEIRVQEGQTSWIRVYNDMENLNVTMHWHGLTAITAPFSDGT 99  Aspergillus nid...
XP_382506     20 KVHDDTFKPDYVLEATLDDIKINCVSRSSIVFNGTSPGPTIYLQEEQTTWIRVYNKIPDNNVTV-------RAAPFSDGT 92  Fusarium gramin...
XP_001226708 103 LGASQWPIPPGHFFDYEIATELEDAGSYFYHSHVGLQALSCTGPLIVEDCGGSPYDYDDERILLFQDHFQRKDQDMIQGL 182 Chaetomium glob...
BAA24288     103 PQGSQWPIPPGHFFDYELQTTVEDAGTYFYHSHVGMQALTASGALIVEGCERPPYQYDDERTLHWSDFFPQTDHEIEVGL 182 Acremonium sp. ...
XP_680658    103 PAASQWPIPPGHFFDYEVKPEPGSAGSYFYHSHVDFQSVTAKGPLIVDSSEPAPYHYDEERTVMISDYFSEPDDEIVDGL 182 Aspergillus nid...
XP_681850    100 PMASQWPIPPGHFFDYEVKVEPGYAGTYFYHSHVGFQAVTAAGPLIVESTKPPPYFYDEERIIALSDFFSKTDKEIEHGL 179 Aspergillus nid...
XP_382506     93 PLVSQWPIPAGQFFDYEIRPEIGDAGSYFYHSHVGFQIVTAFGALIVRDARKPEYKYDGDIPLLVGDNYAAEDEVIEQGL 172 Fusarium gramin...
XP_001226708 183 LATPFTWMGETSGVVLNGKGVALGQTAiegplgeangffgsrrfsgsgavnetsdswngqlgddQIKPSGECTLPVIDVE 262 Chaetomium glob...
BAA24288     183 QSVPLVWPGEVRAVLLNGKGIGIGHEA-------------------------------------DVSPSGDCSLPVIDVD 225 Acremonium sp. ...
XP_680658    183 VSTNFTWSGETEAILVNGQSRPAT------------------------------------------NATGACKLAAISVE 220 Aspergillus nid...
XP_681850    180 MSSQFQWSGETEAVLVNGHSLSPS----------------------------------------PMNGTGSCRREVLQVE 219 Aspergillus nid...
XP_382506    173 LADPFKWSGEPQAITIQGNSGNKSFYE---------------------------------------APDSSCMPHVVHVD 213 Fusarium gramin...
XP_001226708 263 PGKTYRFRFIGATGLSLLSMGFEDHNIMAVIQVDGSeYNEPVAIDHLQLGGGQRFDVLFQTKTVDEL--GDKCTYFLQFE 340 Chaetomium glob...
BAA24288     226 PGKTYRFRFIGATGLSLVSMGFEGHQNLTIIQVDGGeWTKPASVDRIQLASGQRFDALFKAKTEEELasEGRQTYFIQFE 305 Acremonium sp. ...
XP_680658    221 AGKTYRLRFIGATALSFVSLAIESHH-MHIIEADGH-YTKPLETDFLQIGSGQRYSVLLTAKGEDELkaLDRRQFYLQIT 298 Aspergillus nid...
XP_681850    220 PGKTYRLRIIGATALSFISFVIESHD-VEIIEADGH-YTQKLKTHNLQIAGGQRYSVLLKAKDNAALeqLSQRHFIIQIT 297 Aspergillus nid...
XP_382506    214 PGKTYRLRFISATALSMIKLGIEDHENLTVIEADGS-YTKPAKIDHVQVSPGQRYSYLMKTKTSKEVcgGDKSQYWIRYE 292 Fusarium gramin...
XP_001226708 341 TRDRPDPYRGYGVLRY--NLGSPVP-PAPPAPVLNLPTEVNNWLEYTLQPLDSEAGNscPTAEEVTRRVTLLAEEKV--- 414 Chaetomium glob...
BAA24288     306 TRDRPEVYRGYAVIRY--SKASTTP-HVPTIPPLTLPNNTYDWLEYELRPLIETVTQ--PTLGEVTRRVIINASQLT--- 377 Acremonium sp. ...
XP_680658    299 TLERPAVLTSFAVLDYtsDAAPDLT-TVPSPPPLPVATTVQGWLDYELEPA--HPNEdfPTLDEVTRRIVIDVHQNV--- 372 Aspergillus nid...
XP_681850    298 TLARPTTLTTYAILQYpsNAPASLT-NVSATPLMPVPSIAYGWLDYQLQPL--ERDPdfLTSDSVTRRIVIDVHQNF--- 371 Aspergillus nid...
XP_382506    293 SRDRPKVISGYALLKYrcDKNQKLPkSLPETSPIELSNSTADYLEYALEGLSEKNNQafPKLSEVTRTVVIQINQILttg 372 Fusarium gramin...
XP_001226708 415 ----DPTTGRLTWELAHMSWTDSA----RDKPVLVDIYERGQPAIPDYNAAL-ANYGWDPATRLFPARKDEVLEIVIQNT 485 Chaetomium glob...
BAA24288     378 ----DPQNQHVVWRLANLSWTEAV----RQTPLLVDIYKFGDLAIPNYDAAL-ANYGWDPETRAFPAKVGEVLEIVFQNT 448 Acremonium sp. ...
XP_680658    373 -------SDRTIWLQNGYDWVESF----PKSPYLVDIYQDRLDLDASYHRALtRGNGFDNITRTFPARVGEVLEIVWQNR 441 Aspergillus nid...
XP_681850    372 -------SDHVLWLQSGYDWVETF----PETPYLVQIQRGELNVTESLQKAIsAGNNFDKDYRIFPAQLGEVLEIVWQNR 440 Aspergillus nid...
XP_382506    373 ayvnGTLNGTVAWAQNGLPWKENVqaerRQVPYLIQIYENG--TTPNYTLAL-EHHGFDPETKAFPAKVGEVLDIVWENN 449 Fusarium gramin...
XP_001226708 486 GSq--YSGAAGIVETHPFHAHGIHYYDIGGGPGEYDAAANNAKLAelNYKPIRRDTTMLYRYGdGQVEPGAPAGWRAWRM 563 Chaetomium glob...
BAA24288     449 GS---LVGSDGAVDIHPFHAHGEHFYDIGSGDGVYDAEANEAKLVamNYTAVKRDTTMLYHYA-ATTTPGAPAGWRAWRL 524 Acremonium sp. ...
XP_680658    442 G-----TVENGGVDAHPFHAHGRHFYDIGGGDGLYNATANEIRLR--GTHPIQRDTSVLYRYR-SKTSQLVPSGWRAWRI 513 Aspergillus nid...
XP_681850    441 GAvgnSTVRNRGVETHPFHGHGRHFYDIGGGDGEYNAAENEKRLQ--ETQPVLRDTTVLYGYS-REVAPGAPSGWRAWRI 517 Aspergillus nid...
XP_382506    450 ------NGPTGGWDYHPMHVHGYHVYDLGSGNGTYNATENEAHFE--NFTPVLRDTTNLYRYA-VKGVPHHTAGWRAWRI 520 Fusarium gramin...
XP_001226708 564 RMS--HPGVWMVHCHVLGHMLMGmeslwvvgNADDIV 598 Chaetomium globosum CBS 148.51
BAA24288     525 RVT--QPGVWMIHCHILQHMVMG--------KSADAV 551 Acremonium sp. HI-25
XP_680658    514 RVT--NPGVWMYHCHVLQHMIMGmqtvftfgDREDIL 548 Aspergillus nidulans FGSC A4
XP_681850    518 RVT--NPGVWMMHCHTLQHMIMGmqtvfvfgDQDDMK 552 Aspergillus nidulans FGSC A4
XP_382506    521 RITeeNIGAWMMHCHIAQHQVMGmatvwvfgDAEQIR 557 Fusarium graminearum PH-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap