4EMW,3KD9


Conserved Protein Domain Family
CoA_CoA_reduc

?
TIGR03385: CoA_CoA_reduc 
Click on image for an interactive view with Cn3D
CoA-disulfide reductase
Members of this protein family are CoA-disulfide reductase (EC 1.8.1.14), as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol. [Cellular processes, Detoxification]
Statistics
?
PSSM-Id: 163244
View PSSM: TIGR03385
Aligned: 8 rows
Threshold Bit Score: 577.076
Threshold Setting Gi: 488742326
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4EMW_A        14 TCASQIRRLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEKFYDRKQITVKTYHEVIAINDERQTVSVL 93  Staphylococcus ...
Q8CPT6        15 TCASQIRRLDKESEIIVFEKDRDMSFANCALPYYIGNVIEDRRKVLAYTPNQFYDKKQITVKTYHEVIQINDERQTVTVL 94  Staphylococcus ...
Q8U1M0        17 SAASRVKRLRPEWDVKVFEATEWVSHAPCGIPYVVEG-IAPKEKLMHYPPEVFIKKRGIDLHLKAEVIEV--ETGYVRVR 93  Pyrococcus furi...
Q6GIB7        15 TCASQIRRLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRKYALAYTPEKFYDRKQITVKTYHEVIAINDERQTVSVL 94  Staphylococcus ...
WP_000087552  16 SVAARLRRLSEEDEIIMVERGEYISFANCGLPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLSEVVKINKEEKTITIK 95  Bacillus cereus...
WP_002665679  14 SAAAKANRLNKKLDITIYEKTNIVSFGTCGLPYFVGGFFDNPNTMISRTQEEF-EKTGISVKTNHEVIKVDAKNNTIVIK 92  Lyme disease sp...
WP_009991832  15 TAASWVRRLKPNMHVTVFESTKMVSHAPCGIPYFTEGLFDDENLFMTYTPEYFIEKRKINVKTNSKVEEVDLRSRIVVVR 94  Sulfolobus solf...
3KD9_A        17 SAASRVKRLKPEWDVKVFEATEWVSHAPCGIPYVVEGLST-PDKLMYYPPEVFIKKRGIDLHLNAEVIEVD--TGYVRVR 93  Pyrococcus hori...
4EMW_A        94 NRKTNEQFEESYDKLILSPGASANSLGFES----DITFTLRNLEDTDAIDQFIKANQVDKVLVVGAGYVSLEVLENLYER 169 Staphylococcus ...
Q8CPT6        95 NHQTNQTFEESYDTLILSPGASANRLNTHS----DISFTVRNLEDTETIDTFITNTKAQRALVVGAGYISLEVLENLHHR 170 Staphylococcus ...
Q8U1M0        94 ENGEEKSYE--WDYLVFANGASPQIPEIEGvd-lPGVFTADLPPDAVAITEYMEKNKVEDVVIIGTGYIALEMAEAFVTR 170 Pyrococcus furi...
Q6GIB7        95 NRKTNEQFEESYDKLILSPGASANSLGFES----DITFTLRNLEDTDAIDQFIKANQVDKVLVVGAGYVSLEVLENLYER 170 Staphylococcus ...
WP_000087552  96 NVTTNETYNEAYDVLILSPGAKPIVPSIPGieeaKALFTLRNVPDTDRIKAYIDEKKPRHATVIGGGFIGVEMVENLRER 175 Bacillus cereus...
WP_002665679  93 NQKTGTIFNNTYDQLMIATGAKPIIPPINNin-lENFHTLKNLEDGQKIKKLMDREEIKNIVIIGGGYIGIEMVEAAKNK 171 Lyme disease sp...
WP_009991832  95 ENQEKRKYE--FDYLLFSTGARPKKINAEG----DRIFYVHHPAEASYIRQKL--WSFNRIAIIGGGILGIEMAEALRAR 166 Sulfolobus solf...
3KD9_A        94 ENGGEKSYE--WDYLVFANGASPQVPAIEGvn-lKGVFTADLPPDALAIREYMEKYKVENVVIIGGGYIGIEMAEAFAAQ 170 Pyrococcus hori...
4EMW_A       170 GLHPTLIHRSDKI-NKLMDADMNQPILDELDKREIPYRLNEEINAINGNEI---TFKSGKVEHYDMIIEGVGTHPNSKFI 245 Staphylococcus ...
Q8CPT6       171 GLDVTWIHRSTNI-NKLMDQDMNQPIIDEIEKRNITYRFNEEISHVNGHEV---TFTSGKVENFDLIIEGVGTHPNSQFI 246 Staphylococcus ...
Q8U1M0       171 GKNVTLIGRSERVlRKTFDKEITDIVEEKLRQH-LNLRLHEKTLSIEGRERvekVITDGGEYKADLVIIATGIKPNVELA 249 Pyrococcus furi...
Q6GIB7       171 GLHPTLIHRSDKI-NKLMDADMNQPILDELDKREIPYRLNEEIDAINGNEI---TFKSGKVEHYDMIIEGVGTHPNSKFI 246 Staphylococcus ...
WP_000087552 176 GIDVTLVEMANQV-MPPIDYEMAAYVHEHMKNHDVELIFEDGVDALEESGAv-vRLKSGSVIQTDMLILAIGVQPESSLA 253 Bacillus cereus...
WP_002665679 172 RKNVRLIQLDKHIlIDSFDEEIVTIMEEELTKKGVNLHTNEFVKSLIGEKKaegVVTNKNTYQADAVILATGIKPDTEFL 251 Lyme disease sp...
WP_009991832 167 GKKIVLIHRGRYLlNKMLDEDMGKIVTDKVESE-IELKLNESLVSVIEEGRv--VITDKGKYDVDATVVAIGVEPNIDLV 243 Sulfolobus solf...
3KD9_A       171 GKNVTMIVRGERVlRRSFDKEVTDILEEKLKKH-VNLRLQEITMKIEGEERvekVVTDAGEYKAELVILATGIKPNIELA 249 Pyrococcus hori...
4EMW_A       246 ESSNIKLDRKGFIPVNDKFETNVPNIYAIGDIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGN-DtIEFKGFLGNNI 324 Staphylococcus ...
Q8CPT6       247 KSSNVILNDKGYIPVNHNFQTNIPNIYALGDVITSHYRHVNLPAQVPLAWGAHRGASIIAEQLSGNsS-IHFKGYLGNNI 325 Staphylococcus ...
Q8U1M0       250 KQLGVKIGETGAIWTNEKMQTSVENVYAAGDVAETKHVITGKRVWIPLAPAGNKMGYVAGSNIAGK-E-IEFPGVLGTSI 327 Pyrococcus furi...
Q6GIB7       247 ESSNIKLDRKGFIPVNDKFETNVPNIYVIGDIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNdT-IEFKGFLGNNI 325 Staphylococcus ...
WP_000087552 254 KDAGLALGVRGTIKVNEKFQTSDPHIYAIGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHtD-SLYKGTLGTSV 332 Bacillus cereus...
WP_002665679 252 EN-QLKTTKNGAIIVNEYGETSIKNIFSAGDCATIYNIVSKKNEYIPLATTANKLGRIVGENLAGN-H-TAFKGTLGSAS 328 Lyme disease sp...
WP_009991832 244 KD-QLKIGQTGAIWADNHMRTSVENVYAAGDSTESINIITKKPDWVPFAPVANKMGFVAGNNIGGK-D-VTFPGVVGTMI 320 Sulfolobus solf...
3KD9_A       250 KQLGVRIGETGAIWTNEKMQTSVENVYAAGDVAETRHVITGRRVWVPLAPAGNKMGYVAGSNIAGK-E-LHFPGVLGTAV 327 Pyrococcus hori...
4EMW_A       325 VKFFDYTFASVGVKPNELK--QFDYKMVEVTQGAHANYYPGNSPLHLRVYYDTSNRQILRAAAVGKEGADKRIDVLSMAM 402 Staphylococcus ...
Q8CPT6       326 VKFFDYTLASVGIKPNELK--NFDYDMVEVKQGAHAGYYPGNSPLHLRVYFEKDSRKLIRAAAVGKQGADKRIDVLSMAM 403 Staphylococcus ...
Q8U1M0       328 TKFMDLEIGKTGLTENEAVkeGYDVRTAFIKANTKPHYYPGGREIWLKGVVDNETNRLLGVQAVGAE-ILPRIDSAAAMI 406 Pyrococcus furi...
Q6GIB7       326 VKFFDYTFASVGVKPNELK--QFDYKMVEVTQGAHANYYPGNSPLHLRVYYDTSNRQILRAAAVGKEGADKRIDVLSMAM 403 Staphylococcus ...
WP_000087552 333 AKVFDLTVASTGVNEKILKrlNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKDSGKIYGAQALGRDGVDKRMDVIATAI 412 Bacillus cereus...
WP_002665679 329 IKILSLEAARTGLTEKDAKklQIKYKTIFVKDKNHTNYYPGQEDLYIKLIYEENTKIILGAQAIGKNGAVIRIHALSIAI 408 Lyme disease sp...
WP_009991832 321 TKFEEFIIGKTGVTENEAKryNIKTVSAIVHHKTRARYYPGSKDIIVKLIAEADTMRIIGAQIVGEEEVLGRLNMMAAVI 400 Sulfolobus solf...
3KD9_A       328 TKFMDVEIGKTGLTEMEALkeGYDVRTAFIKASTRPHYYPGGREIWLKGVVDNETNRLLGVQVVGSD-ILPRIDTAAAML 406 Pyrococcus hori...
4EMW_A       403 MNQLTVDELTEFEVAYAPPYSHPKDLINMIG 433 Staphylococcus aureus subsp. aureus USA300
Q8CPT6       404 MNNATVDDLTEFEVAYAPPYSHPKDLINLIG 434 Staphylococcus epidermidis ATCC 12228
Q8U1M0       407 TAGFTTKDVFFTDLAYAPPFAPVWDPLIVLA 437 Pyrococcus furiosus DSM 3638
Q6GIB7       404 MNQLTVDELTEFEVAYAPPYSHPKDLINMIG 434 Staphylococcus aureus subsp. aureus MRSA252
WP_000087552 413 KANLTVLDLPDLELSYAPPYSSAKDPVNMVG 443 Bacillus cereus group
WP_002665679 409 YSKLTTKELGMMDFSYSPPFSRTWDILNIAG 439 Lyme disease spirochete
WP_009991832 401 QKGFTAEDLFFVETGYVPPVNRVWDVVTLAA 431 Sulfolobus solfataricus
3KD9_A       407 MAGFTTKDAFFTDLAYAPPFAPVWDPLIVLA 437 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap