Conserved Protein Domain Family

TIGR03385: CoA_CoA_reduc 
Click on image for an interactive view with Cn3D
CoA-disulfide reductase
Members of this protein family are CoA-disulfide reductase (EC, as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol. [Cellular processes, Detoxification]
PSSM-Id: 163244
Aligned: 8 rows
Threshold Bit Score: 577.076
Threshold Setting Gi: 488742326
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
4EMW_A       403 MNQLTVDELTEFEVAYAPPYSHPKDLINMIG 433 Staphylococcus aureus subsp. aureus USA300
Q8CPT6       404 MNNATVDDLTEFEVAYAPPYSHPKDLINLIG 434 Staphylococcus epidermidis ATCC 12228
Q8U1M0       407 TAGFTTKDVFFTDLAYAPPFAPVWDPLIVLA 437 Pyrococcus furiosus DSM 3638
Q6GIB7       404 MNQLTVDELTEFEVAYAPPYSHPKDLINMIG 434 Staphylococcus aureus subsp. aureus MRSA252
WP_000087552 413 KANLTVLDLPDLELSYAPPYSSAKDPVNMVG 443 Bacillus cereus group
WP_002665679 409 YSKLTTKELGMMDFSYSPPFSRTWDILNIAG 439 Lyme disease spirochete
WP_009991832 401 QKGFTAEDLFFVETGYVPPVNRVWDVVTLAA 431 Sulfolobus solfataricus
3KD9_A       407 MAGFTTKDAFFTDLAYAPPFAPVWDPLIVLA 437 Pyrococcus horikoshii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap