Conserved Protein Domain Family
betaine_BetI

?
TIGR03384: betaine_BetI 
transcriptional repressor BetI
BetI is a DNA-binding transcriptional repressor of the bet (betaine) regulon. In sequence, it is related to TetR (pfam00440). Choline, through BetI, induces the expression of the betaine biosynthesis genes betA and betB by derepression. The choline porter gene betT is also part of this regulon in Escherichia coli. Note that a different transcriptional regulator, ArcA, controls the expression of bet regulon genes in response to oxygen, as BetA is an oxygen-dependent enzyme. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 132427
View PSSM: TIGR03384
Aligned: 18 rows
Threshold Bit Score: 229.848
Threshold Setting Gi: 499358523
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004921794   4 RRVKPEHVRREEIVNAAYEVIFEVGLSNTTMAQIAKKAQLSVGIVSHYFGDKQGLINACMLEMLNVLRRKTAQYKAevQ- 82  Acinetobacter
WP_011093320   2 PKVGMQPIRRQQLIEATLAAINDVGMHDASIVQIARRAGVSNGIISHYFRDKNGLLEATMRYLISHLGLAVKSRLL--Nl 79  Pectobacterium ...
WP_001014636   8 PKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGIISHYFRDKNGLLEATMRDITSQLRDAVLNRLH--Al 85  Escherichia coli
WP_011330045   2 PKVGMEPIRRQQLIDATIESVAQRGLQATTINSISKNAGLSSGIISHYFGGKQGLIEATVRYLLTSLKQELVCKLE--A- 78  Pseudoalteromon...
WP_011394817   2 PKIVVEAEKKEQLIEATLKSVEAYGIPGTTINSISRYAGVSTGIISHYFGGKQALMEATVRYLLEALKTSLLKELA--Kt 79  Hahella chejuensis
WP_004201076   9 PKLGMREIRRAQLIDATLRSIDEAGLPGTTLASVAQRANISTGIVSHYFGDKDGLLEATMRHVLRDLWAATTRRRA--Aa 86  Burkholderia ma...
WP_011495168   2 ARPEMKSLRQKQLIEATLESVAKHGLHHTTINTISGLAGMSSGIISHYFGGKQGLIEATQRHLLEQLKQALLMRVS--Gh 79  Shewanella deni...
WP_010967911   2 ALTKISDIRRRELRRAAVEVMKREGAAGTTLEKVAQEAGASKGIVLHYFRNKQELFEEAMREANAGLRDDVVRRLK--K- 78  Sinorhizobium m...
WP_011539213   2 ARKRIRDIRNEELIEATIITVHKRGYGTVTMAEIAREAGASAASISYYFGSKEGLMEATMRHLLRKLRKAMVEGYA--Q- 78  Ruegeria sp. TM...
WP_010972028   2 RLTKISDIRRAELRRAAFEVLQREGMAGATLERVAAQAGASKGIVLHYFASKQELFEHAMREANVKLAEVVVARLN--R- 78  Agrobacterium f...
WP_004921794  83 -DSHPESMIKAIIDSNFDISQVNQRAMRIWLDFWSASMHMPELSRLQRINDQRLYSNLKFHFLELMPKDQASIAARGLAA 161 Acinetobacter
WP_011093320  80 tENTPRARLRAIVQGNFDDSQTNSAAMKTWLAFWASSLHSPMLHRLQQVNDRRLYSNLSVEFSRCLPKDKARIAAKGVAG 159 Pectobacterium ...
WP_001014636  86 pQGSAEQRLQAIVGGNFDETQVSSAAMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPREQAQEAGYGLAA 165 Escherichia coli
WP_011330045  79 -NTNATQRLMFIIEANFALVQQRSDTTRTWLSFWAQSMHDAELHRLQNVNSKRLQSNLAFSFKQLMPAEQAKQAAELSAA 157 Pseudoalteromon...
WP_011394817  80 sDGSPYSRLLSIVEANFSKLQVSERAAKTWMAFWAQAMHDPQLARLQRVNERRLFSNLKVSLREILPPSQVEDQAHAIAA 159 Hahella chejuensis
WP_004201076  87 -SDAPRARLRAVVAANFDDTQISAPVMKTWLAFWSQSMHEPTLRRLQRVNTRRLHSNLCAEFAKTLPRARAREAASGLAA 165 Burkholderia ma...
WP_011495168  80 -SLTPKQRLMMIVEANFTELQRSTPATKTWLSFWSQAMHEPGLARLQNINSQRLYRNLRFSFRQLLNDEQATNAAKQAAA 158 Shewanella deni...
WP_010967911  79 -ARSPIERIWAIVEANLGEDVFKPPHGHAWLSLCAEAPREPQLARLQSIFHARMHSNLMSGFRSLVPHSQAERLSLSMSA 157 Sinorhizobium m...
WP_011539213  79 -ARSPLERLYAVMDANFADSLYSVPQCSIWMQFWANAPYSPSLARLHRINRARVRSHFVAELSQLVPADQVETARQALQS 157 Ruegeria sp. TM...
WP_010972028  79 -ATSPRERLEAIIEANFDESFFQPSICHAWLSLCAEVPREPQLGRIQKVIHARMRSNLLSALRHLVPKGDCEPIALGITT 157 Agrobacterium f...
WP_004921794 162 LIDGLWLRGSLSqDTT-FDSTLARSIAYDYVDTQL 195 Acinetobacter
WP_011093320 160 LIDGLWLRGALS-HNV-FNCEEALSITYDYIDQQL 192 Pectobacterium atrosepticum
WP_001014636 166 LIDGLWLRAALS-GKP-LDKTRANSLTRHFITQHL 198 Escherichia coli
WP_011330045 158 MIDGLWLRAVLSkSNE-HQFNHSEKLAKSYVHSLI 191 Pseudoalteromonas haloplanktis
WP_011394817 160 LIDGLWLRSALS-SGG-LSVVQAERICKNYVSELF 192 Hahella chejuensis
WP_004201076 166 LIDGLWLRGALA-GKP-LDTKAALKLANDYIDQLL 198 Burkholderia mallei
WP_011495168 159 MIDGFWLRSALS-QTPeLAFAQAEHLCKAFIETLV 192 Shewanella denitrificans
WP_010967911 158 LIDGLWVRLGIG-DRT-MTSSTATSLARDLLTNAL 190 Sinorhizobium meliloti
WP_011539213 158 YMDGVWLQAAQS-EQP-LDTEAARTAAHRVVDlvt 190 Ruegeria sp. TM1040
WP_010972028 158 LIDGLWLRSGLQ-SGG-LSREEALAQMRDYLLHRL 190 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap