2EWO,3H7C


Conserved Protein Domain Family
agmatine_aguA

?
TIGR03380: agmatine_aguA 
Click on image for an interactive view with Cn3D
agmatine deiminase
Members of this family are agmatine deiminase (3.5.3.12), as characterized in Pseudomonas aeruginosa and plants. Related deiminases include the peptidyl-arginine deiminase (3.5.3.15) as found in Porphyromonas gingivalis. [Central intermediary metabolism, Polyamine biosynthesis]
Statistics
?
PSSM-Id: 132423
View PSSM: TIGR03380
Aligned: 19 rows
Threshold Bit Score: 655.531
Threshold Setting Gi: 238537983
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EWO_A         8 TTPKQDGFRXPGEFEKQKQIWXLWPWRNDNWRLGAKPAQKAFLEVAEAISEFEPVSLCVPPLQYENALARVSElgshNIR 87  Streptococcus m...
Q8YAS5         6 SSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQKAFVDVATAISHFEPVTVVASSSQYVNARYMLSD----EIR 81  Listeria monocy...
Q8RPX2         6 TSPKKDGYRMPGEFEAHKDVYLLWPERPDNWREGAKPAQATFAKVAETIAQFESVTVGVSDRQYTNARHMLAD----NIQ 81  Lactobacillus s...
Q725C4         6 GLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQNYKEVAVAISNFEPVTMFVSPNQYKNARKELPD----TIR 81  Listeria monocy...
Q8EIF2        13 TKPSQDGFYMPAEWAAQQAVWMIWPYRPDNWRAAGAYAQATFAKVVDAIGAATPVYMGVPKAFLAKAKTVMPS----HVT 88  Shewanella onei...
Q666N7         9 GTPRQDGFFMPAEWAPQDAVWMLWPYRQDNWRGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPA----NVT 84  Yersinia pseudo...
Q87NU5         5 TTPAQDGFYFPAEFQPVSEVWLAWPERKDNWRDDALPAQETFARIANLIAEVTKVCVAVCSHNFDRARQMLHS----DVR 80  Vibrio parahaem...
WP_011506485  13 ATPAELGFSMPAEFAPHDACWMLWPQRPDNWRYGAKPAQAAFVAVARAIAESETVFVGVNDDQYENARNQLPS----RIR 88  Chromohalobacte...
WP_011373786   6 TTPKEDQYYLPAETKRHRESIMMWPERSDNWRNGAKPAQKTFAEIAAIINRYEPVTMLVSKEQYQNARHALPA----EIR 81  Lactobacillus s...
WP_011668777   5 QTPVQDGFRMPGEFEDQAESYLIWPERPDNWREGGKPAQKAFAQLAETIATYEPVTMLVNQGQYTHARTVLSP----AVR 80  Lactobacillus b...
2EWO_A        88 IIEXTNDDAWIRDCGPTFLVNDKGDLRAVDWEFNAWGGLVDGLYFPWDQDALVARKVCEIEGVDSYKTkDFVLEGGSIHV 167 Streptococcus m...
Q8YAS5        82 VVEMDNDDAWVRDSGPTFVVNDSGDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLaDFVLEGGSIHV 161 Listeria monocy...
Q8RPX2        82 VVEMSNNDSWIRDCGPTFVVNDKGDSRGVDWTFNAWGGLVDGLYFPWDKDDRVAQKVCEIEGRDRYRLdDLVLEGGSTHV 161 Lactobacillus s...
Q725C4        82 VIEMSNDDAWIRDYGPSFLVNDKGEMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCDLERLDYYSQkDFILEGCSIHV 161 Listeria monocy...
Q8EIF2        89 LVEMDSNDCWARDTGPTVVVNAEGECRGVDWGFNAWGGHNGGLYFPWDKDEQVAQQMLAQHGFARYRA-PLILEGGSIHV 167 Shewanella onei...
Q666N7        85 LVEMASDDAWMRDTGPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSA-PLILEGGSIHT 163 Yersinia pseudo...
Q87NU5        81 LVEIPFNDAWMRDIGPTVLVNQAGERRGISWQFNAWGGEYNGLYDNWQQDDLVAGSVCDIIGIDYYRA-PFVLEGGAIHT 159 Vibrio parahaem...
WP_011506485  89 VIELSSNDAWMRDVGPTFLTHPDGRLAMVDWEFNAWGGLNGGLYFPWDKDRRIRQKIAEVLGIERFIT-PLVVEGGAIHV 167 Chromohalobacte...
WP_011373786  82 VIEMSYNDAWIKDIGPTYLLNQKNQIRAVDWRFNAWGGLVDGLYFPWDMDDQVAQKLCELTGIDYYHLeKFILEGCAFHT 161 Lactobacillus s...
WP_011668777  81 VVEMSSNDAWMKDVGPFYVVNDTGELRAVDFQFNAWGGLLDGLYFPWDQDNRIGKKVADLQRIPVYEA-QFVLEGCAIHV 159 Lactobacillus b...
2EWO_A       168 DGEGTVLVTEXCLLHPSRNP-HLTKEDIEDKLKDYLNCVKVLWVKDGIDPYETNGHIDDVACFIRPGEVACIYTDDKEHP 246 Streptococcus m...
Q8YAS5       162 DGEGTLVTTEECLLSEGRNP-QLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFNYVRPGVVALAWTDDETDP 240 Listeria monocy...
Q8RPX2       162 DGEGTLLVTEECLLSDGRNP-QLSKEQIESILKEYLNVEKIIWLKKGIYLDETNGHVDNIANFVKPGQVVLAWTDDQSDP 240 Lactobacillus s...
Q725C4       162 DGEGTLVTTEECLLSEGRNP-NLTKIEIEQTLKKYFHVQKVIWLKHGFYLDETNGHVDNIFNFVAPGEVVLSWTDNKSDP 240 Listeria monocy...
Q8EIF2       168 DGEGTCMTSAECLLNANRNP-ELTKEQIEGLLRDYLNVKQFIWLQDGVYMDETDGHIDNMCCFARPGEVILHWTDDESDP 246 Shewanella onei...
Q666N7       164 DGEGTLLTTAECLLNPNRNP-HLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETDGHIDNMCCFVRPGEVALHWTDDQQDP 242 Yersinia pseudo...
Q87NU5       160 DGEGTLYTTEECLLSPGRNP-QLSKAQIEEQLKVYLGIEKIIWLPNGLFNDETDGHVDNLMHVIAPGKVVLSWTDDPSDP 238 Vibrio parahaem...
WP_011506485 168 DGEGTLITTEECLLNPNRNP-DLAKPEIERLLCAYLGVEKIIWLPRGCFQDETDGHVDNLCCFVAPGEVALTWTDDDSDP 246 Chromohalobacte...
WP_011373786 162 DGEGTLIVTEESILSEGRNG-MLTKTEVEAVLKAYLGIEKVIWLKLGYFMDETNGDVDNMLSFVRPGELLLTWTDDQSDP 240 Lactobacillus s...
WP_011668777 160 DGQGTLIATEDVVLSEGRNPgGLTKAVAEQIFHDYLGITKTVWLPHGYFMDETNGDIDNLINFVAPGELVLTWTDDKHDP 239 Lactobacillus b...
2EWO_A       247 FYQEAKAAYDFLSQQTDAKGRPLKVHKXCVTKePCYL--QEAATIDYVEGSIPREEGEXAIASYLNFLIVNGGIILPQYG 324 Streptococcus m...
Q8YAS5       241 QYEISKECFDILSNETDAKGRKLEVHKINVPK-PILItdEESKGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFG 319 Listeria monocy...
Q8RPX2       241 QYAISKENYDMLINETDAKGRKLQVEKLYLPK-PILIteAESQGVDTVDGTLPRLAGDRLAASYVNYYTANGGIVFPLFN 319 Lactobacillus s...
Q725C4       241 QYEISRECYDILANQTDAKGRTFMIHKLHCPD-PVLItqTESEGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFD 319 Listeria monocy...
Q8EIF2       247 QYPRSKAALEVLQNTVDAQGRKLKIHLLPQPG-PLYCseEESKGVTEGTG-VPRTAGERLAGSYVNFLITNHRIVFPLLD 324 Shewanella onei...
Q666N7       243 QYARSVAAFEVLSNTVDAKGRKLKIWKLPAPG-PLYNteEETFDVLTSDA-VPRTAGERLAGSYVNFLISNQQIIFPLLD 320 Yersinia pseudo...
Q87NU5       239 QYALSRQAEQVLKSQHDAKGREIEIVRLPLPG-PLHYseREANGIDASSG-MSRQAGERLSASYANFLIVNGHVFLPMLD 316 Vibrio parahaem...
WP_011506485 247 QHAISREALGILEAATDARGRRLTVHKLPMPG-PLTIaeTEASGVDRLSSSRPRQPGDRMAASYVNFYIGNSVVVMPRLD 325 Chromohalobacte...
WP_011373786 241 QYASSEEAYRILEAATDTKGRHFKIHKLQMPK-PMFAtqEESAGVDPINGLLPRYPGDRLTASYVNYYALNDAIILPIFD 319 Lactobacillus s...
WP_011668777 240 QYEISRQAYELLQQATDAQGRRFKIHKLQIPR-ILTLsdAEAQGVDPINGRLPRVAGQRLTASYVSYITTNRAILMPVFD 318 Lactobacillus b...
2EWO_A       325 DENDQLAKQQVQEXFPDRKVVGVRTEEIAYGGGNIHCITQQQPA 368 Streptococcus mutans
Q8YAS5       320 DPNDELAREKLQQLYPNCEVVGVKAREILLGGGNIHCITQQVPR 363 Listeria monocytogenes EGD-e
Q8RPX2       320 DPMDEKAQEILQKLYPDRKIVGVPAREILLGGGNIHCITQQIPA 363 Lactobacillus sakei subsp. sakei 23K
Q725C4       320 DPKDKDAQELLEQLYPDRKIVGIKAREILLGGGNIHCITQHLPD 363 Listeria monocytogenes serotype 4b str. F2365
Q8EIF2       325 PATDDIAAQKLQEIFPEHEIVGVPAREILLGGGNIHCITQQIPA 368 Shewanella oneidensis MR-1
Q666N7       321 SRTDGQANDLLQQMFPGYAIVGVPAREILLGGGNIHCITQQIPA 364 Yersinia pseudotuberculosis IP 32953
Q87NU5       317 EDTDAIAIDILQNAMPEYQIIAIPSREVLLGGGNIHCITQQIPA 360 Vibrio parahaemolyticus RIMD 2210633
WP_011506485 326 PAHDDEAHAILENLFPGRRVVAVDAREILLGGGNIHCITQQQPR 369 Chromohalobacter salexigens
WP_011373786 320 DPQDTVAIQTLTQLFPDRKIEPVYARELLLGGGDVHCVVAAVPA 363 Lactobacillus sakei
WP_011668777 319 DLQDAVAHRQLAALYPNRQVVDVSANEILTGGGNIHTIAAGVPG 362 Lactobacillus brevis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap