Conserved Protein Domain Family

TIGR03380: agmatine_aguA 
Click on image for an interactive view with Cn3D
agmatine deiminase
Members of this family are agmatine deiminase (, as characterized in Pseudomonas aeruginosa and plants. Related deiminases include the peptidyl-arginine deiminase ( as found in Porphyromonas gingivalis. [Central intermediary metabolism, Polyamine biosynthesis]
PSSM-Id: 132423
Aligned: 19 rows
Threshold Bit Score: 655.531
Threshold Setting Gi: 238537983
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q8RPX2       320 DPMDEKAQEILQKLYPDRKIVGVPAREILLGGGNIHCITQQIPA 363 Lactobacillus sakei subsp. sakei 23K
Q725C4       320 DPKDKDAQELLEQLYPDRKIVGIKAREILLGGGNIHCITQHLPD 363 Listeria monocytogenes serotype 4b str. F2365
Q666N7       321 SRTDGQANDLLQQMFPGYAIVGVPAREILLGGGNIHCITQQIPA 364 Yersinia pseudotuberculosis IP 32953
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap