Conserved Protein Domain Family
glycerol3P_GlpC

?
TIGR03379: glycerol3P_GlpC 
glycerol-3-phosphate dehydrogenase, anaerobic, C subunit
Members of this protein family are the membrane-anchoring, non-catalytic C subunit, product of the glpC gene, of a three-subunit, FAD-dependent, anaerobic glycerol-3-phosphate dehydrogenase. GlpC lasks classical hydrophobic transmembrane helices; Cole, et al suggest interaction with the membrane may involve amphipathic helices. GlcC has conserved Cys-containing motifs suggestive of iron-sulfur binding. This complex is found mostly in Escherichia coli and closely related species. [Energy metabolism, Anaerobic]
Statistics
?
PSSM-Id: 132422
View PSSM: TIGR03379
Aligned: 7 rows
Threshold Bit Score: 767.776
Threshold Setting Gi: 499537322
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005694608  26 DESFESCIKCTACTAVCPVSRNNPLYPGPKQSGPDGERLRLKSAELYDEALKYCTNCKRCEVACPSDVKIGDLIVRARNN 105 Haemophilus inf...
WP_001000379   3 DTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCKRCEVACPSDVKIGDIIQRARAK 82  Enterobacteriaceae
WP_011706293   7 NQTFDQCIKCTVCTAYCPVAKANPAYPGPKQAGPDGERLRIKSPELFDSALKYCTNCKRCEVACPSGVRIGDIIAKAKHQ 86  Aeromonas hydro...
WP_011191517  26 DNSFESCIKCTVCTTYCPVAKVNPLYPGPKQAGPDGERLRLKDPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKAS 105 Yersinia pseudo...
WP_001014995  12 NTTFDQCIKCTVCTVYCPVAKANPNYPGPKQCGPDGERLRIKSAEYYDDALKLCTNCKRCETACPSGVKIGDMIAVARGK 91  Vibrio cholerae
WP_011608671  24 DESFESCIKCTACTVVCPVSRQNPFYPGPKQAGPDGERLRLKSAALYDEALKYCINCKRCEVACPSDVKIGDIIIRARNK 103 Histophilus somni
WP_011218105   7 DTSFDQCIKCTVCTVYCPVAKANPEFPGPKQCGPDGERLRIKSPEFYDELLKLCTNCKRCETACPSGVKIGDLIAVARDK 86  Photobacterium ...
WP_005694608 106 HlaQSKKPlmnKLRDAILSNTDVMGKINTPLAPIVNTITGLKATKFMLEKTLNISKKRTLPKYAFGTFRSWYMKNAlQDQ 185 Haemophilus inf...
WP_001000379  83 Y--DTTRP---SLRNFVLSHTDLMGSVSTPFAPIVNTATSLKPVRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVA-AQQ 156 Enterobacteriaceae
WP_011706293  87 Y--SGFKP---GIREFVLSHTDLMGSMSTLMAPVVNFTTGLKPMKLVLDKALGVSSHRDLPKYSQGTFRGWYKKQK-ASQ 160 Aeromonas hydro...
WP_011191517 106 H--STNKP---KLRDAILSHTDIMGTLSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKYSFGTFRRWYRKQA-EKQ 179 Yersinia pseudo...
WP_001014995  92 Y--GKKPLnpkLVRDFVLSHTDLFGSIATPFAPLVNAATSLPLVKKLMHKTIGVHDHKTLPKYSHGTFRRWFKQNC-TSQ 168 Vibrio cholerae
WP_011608671 104 YldQQHKSpihKLRDAVLSNTDIMGKMNTPFAPIVNAITGLKATRYVLDKTLKVSKHRTLPKYSFGSFRQWYKKYAlDRQ 183 Histophilus somni
WP_011218105  87 H--AKKPFnikTIRDFVLSHTDLMGSVATPFAPIVNTITSIKPIKKIMHKTIGVHDHKSLPKYSHGTFRRWYKQNC-TSQ 163 Photobacterium ...
WP_005694608 186 QKFERKVAYFHGCYVNYNNPQLGKEFLKVFNAMNIGVMLLEKEKCCGLPLMVNGFPNRARNIAQFNTDYIGKMVDENGID 265 Haemophilus inf...
WP_001000379 157 AQYKDQVAFFHGCFVNYNHPQLGKDLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIP 236 Enterobacteriaceae
WP_011706293 161 ARFERQIAYFHGCYVNYNHPQLGKELVQVLNAMNIGVQLLEREKCCGVPLIANGFMDKAKQQAAFNIKQLENTLLGNEMP 240 Aeromonas hydro...
WP_011191517 180 QQYTEQVAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKREKCCGVPLIVNGFIEQAKKQARVNLESLTDTVIGRDIP 259 Yersinia pseudo...
WP_001014995 169 PLYQRQVAYFHGCYVNYNHPQLGKDFVRVMNAMNIGVRLLDSEKCCGVPLIANGFHNKARKNALHNVKHLTAMVNDYHAP 248 Vibrio cholerae
WP_011608671 184 IYFRDKIVYYHGCYVNYNYPQLGKDLIKVLNSIDIGVILLEKEKCCGLPLMVNGFPEKAKKQAEFNIKQIERVIQEKALD 263 Histophilus somni
WP_011218105 164 ALYPQQVHYFHGCFVNYNHPQLGKDFVKIMNAMSIGVQLLDKEKCCGVPLIANGFFDKAKKNAKLNVRNFEAAIEKYDSS 243 Photobacterium ...
WP_005694608 266 VISEASSCSLNLRDEYHHILGIDNAKVRPHIHMVTPFLYQLFKEGKTLPLKPL------------KLRVAYHTACHVDKA 333 Haemophilus inf...
WP_001000379 237 VIATSSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPL------------PLKVVYHTPCHMEKM 304 Enterobacteriaceae
WP_011706293 241 LLATSSTCGFTLRDEYPHLLEQDNHKVRDRISLVTRFLWNEFYKGNKPAMKPL------------NLHIAYHTPCHMEKM 308 Aeromonas hydro...
WP_011191517 260 VVATSSSCTFTLRDEYPHLLDVDTTPVRDKVELATRYLYRLLDQGRELPLKPLfslnpllasqeaPLRIAYHTPCHMEKM 339 Yersinia pseudo...
WP_001014995 249 VLSTSSTCSFTLQQEYPHVLGVDNSQVVDQIHYVTRFLLKEFMSGNAPKMKPV------------HKKVVYHTPCHLERS 316 Vibrio cholerae
WP_011608671 264 IIGTSSSCTMNLRDEYHHILGMDNARIRPHVNIATKYLYRLYLDGKIPHFKST------------PLKVAYHTACHVEKA 331 Histophilus somni
WP_011218105 244 IISTSSTCSFTLREEYPHVLKVDNANVADKIEYVTRFLLKQFMNGNTPKMKPI------------NKKIVYHTPCHLERT 311 Photobacterium ...
WP_005694608 334 GWAPYTLEVLKKIPSLEIIMLPSQCCGIAGTYGFKSENYEISQSIGKNLFDNINEGGFDYVISECQTCKWQIDMSSNVTC 413 Haemophilus inf...
WP_001000379 305 GWTLYTLELLRNIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEESGADLVVTDCETCKWQIEMSTSLRC 384 Enterobacteriaceae
WP_011706293 309 GGVIYTLELLRAIPGVKVTVLDSQCCGIAGTYGFKSENYQTSQAIGEGLFDQINRLKPDLVITDCETCKWQIEMSTPFPC 388 Aeromonas hydro...
WP_011191517 340 GWTAYTLALLQRIPGVELVVLDSQCCGIAGTYGFKSENYATSQGIGASLFQQIEDSGVDLVITDCETCKWQIEMSTSKKC 419 Yersinia pseudo...
WP_001014995 317 GNVMFTIELLKMVPGLELVVLDSECCGLAGTYGFKEENYEVSKKIGSHLFDAIQTSDADYAVTDCETCKWQIEENAHLET 396 Vibrio cholerae
WP_011608671 332 GWAPYTLALLKQIPDLDVTILPSQCCGIAGTYGFKSENYQTSQAIGKSLFEVIEQGCFDYVITECETCKWQIDMSTSASC 411 Histophilus somni
WP_011218105 312 GGNLYTIELLKMIPGLEVVVLDSQCCGLAGTYGFKTENYDTSIAIGESLFKQIRQSNADFAITDCETCKWQIEENTQLET 391 Photobacterium ...
WP_005694608 414 IHPLTLLCMSMD 425 Haemophilus influenzae
WP_001000379 385 EHPITLLAQALA 396 Enterobacteriaceae
WP_011706293 389 EHPIHLLARALA 400 Aeromonas hydrophila
WP_011191517 420 EHPITLLARVLA 431 Yersinia pseudotuberculosis
WP_001014995 397 IHPVSLLAMALI 408 Vibrio cholerae
WP_011608671 412 LHPVSLLARALN 423 Histophilus somni
WP_011218105 392 IHPISLLAMAIQ 403 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap