2QNU


Conserved Protein Domain Family
VI_minor_4

?
TIGR03373: VI_minor_4 
Click on image for an interactive view with Cn3D
type VI secretion-associated protein, BMA_A0400 family
Members of this protein family are found exclusively, although not universally, in bacterial species that possess a type VI secretion system. Genes are found in type VI secretion-associated gene clusters. The specific function is unknown. This model represents the rather well-conserved amino-terminal domain of a protein family in which carboxy-terminal regions, when present, show little conservation. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 132416
View PSSM: TIGR03373
Aligned: 25 rows
Threshold Bit Score: 112.429
Threshold Setting Gi: 499874057
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QNU_A         5 GFYGXLAGRGDFVSRGLPNTFVEPWDAWLASGXRASQDELGAAWLDAYLTSPLWRFAIapGLLGGEAVTGVVXPSIDRVG 84  Pseudomonas aer...
WP_011355194  21 AWYGKIPGAGDFVNSRLPHALALWWERWLQQGMAAMRQRGADEIERHYTVAPVWNFLIpaGAGASCIQPGCLAPSCDRVG 100 Burkholderia lata
WP_011287928  10 tCFGKIPSRGDFVKGAGQHQLISVLDRWVSQTMELLSED--PRWKSAYDSACAVDFAFi-GARSRLSVVGHLRPSTDSSG 86  Dechloromonas a...
KDB60764      17 GWYGKIPAAGDFMRRRLSHGLVAWWDKWLQYGLAALRQMPAGGAERAYAAAPLWNFAIpaGAGAGAVLLGGMAPSRDRVG 96  Bordetella bron...
WP_004521958  10 AYFGKIPSRGDFVKSAHNPQLLQTLDHWIARAMELLADD--PRWKIVYESAKPMHFAFl-GSKSRLAIAGHMIASHDASN 86  Burkholderia ps...
WP_004928987   9 lYYGKSPARGDFLKSKGQHTLIQLIDQWITEALEHAMQK--DQFREAYASFPALDFFIa-NPQEKMFLAANLITSRDSSG 85  Acinetobacter
WP_002551416   3 GCFGKVPASADFVSLHGASDDVCEFDAWLQGALADMQQR--DDWRTLFDQLPVCFFSY--RARSGNWLVGGLISSRDSSA 78  Pseudomonas sav...
WP_011004060   9 SYFGKLPSRGDFVKSANNVQLLDTLDRWLAQGMELLAE--APDWKATYDTWQPVQFAFl-GSQSRLAIAGTLMASSDLSS 85  Ralstonia solan...
WP_011507557   3 GCFGKIPAKADFVGVNAAGVVIQELDQWLQSALLQFLDH--DDWKHRFDALPVCFFNY--HARNGSDVSGAMISSSDASG 78  Chromohalobacte...
WP_011259979  10 SYFGKVPSRGDFVRAADNHQLLGWLDRWAGLSVDLLSQN--PDWKRLYDEAPDIHYAFl-GSRSKMVLCGHFQPSRDASQ 86  Xanthomonas oryzae
2QNU_A        85 RYFPLTVACLLPANADLGGLVGGD----DGWFEQVESl-L-LSTLEPEAEVEAFEQAVAQLP 140 Pseudomonas aeruginosa PAO1
WP_011355194 101 RYYPVIVTLPMRAADYWNGLPDAA----DAFYWQVGQa-L-LDAIRHARAPGDLEQMLERVR 156 Burkholderia lata
WP_011287928  87 RRFPFIAAATIERDDALMFRCAPV----GLAYSFGALarI-SEAGVNGAEVGGLLAELDSIn 143 Dechloromonas aromatica
KDB60764      97 RAYPLSAMAVVPAQAYQPGLLEDA----GDYYRQLGAt-L-LAAVRRGGAAEQLDRQLQAMP 152 Bordetella bronchiseptica B18-5 (C3)
WP_004521958  87 RRFPFLAATALEVDRPLTFLARSPlafaRLWSRA--Aa-Q-MQSLLGPQEPPGALQALGDTQ 144 Burkholderia pseudomallei
WP_004928987  86 RPFPMVLGHLLDVEQPYENMLFAPy---RYKMVLVDLy-QkNKVLKTIQEPSILLEKLNHLS 143 Acinetobacter
WP_002551416  79 RRYPFFIFQTVKSSDAGVFVNPFTl--sELFAGQIKP--L-LHMAAQGEGTSVLFERIRALR 135 Pseudomonas savastanoi
WP_011004060  86 RRFPFLTATAMEVERPINFIARSPlalaRLWTRAGQ---Q-MISLARAADATEGLRLLAESQ 143 Ralstonia solanacearum
WP_011507557  79 RRYPFFIFQMLKAEGRPGVLPYIHtl-gEIFAGQARD--I-LTDSVHGQSPIDPVEAIQELR 136 Chromohalobacter salexigens
WP_011259979  87 RRFPLLSAVRLEASEPLSFIARSPlamsKVWSGLSR---M-AKQAMVADDAGPALTALADTR 144 Xanthomonas oryzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap