Conserved Protein Domain Family
putres_am_tran

?
TIGR03372: putres_am_tran 
putrescine aminotransferase
Members of this family are putrescine aminotransferase, as found in Escherichia coli, Erwinia carotovora subsp. atroseptica, and closely related species. This pyridoxal phosphate enzyme, as characterized in E. coli, can act also on cadaverine and, more weakly, spermidine. [Central intermediary metabolism, Polyamine biosynthesis]
Statistics
?
PSSM-Id: 132415
View PSSM: TIGR03372
Aligned: 2 rows
Threshold Bit Score: 952.546
Threshold Setting Gi: 122064659
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8FDF5   8 ASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYRKSVTAGGDYGAVEWQAGGLNTLVDTQGQEFIDC 87  Escherichia coli CFT073
Q6D6Y6   8 LNPLECTQQALHWIHSDTLSPDDMAALNQEVLSCFREYVNPGFLEYRKSVTTGGDYGAVEWRASGPNTLIDTQGNEYLDC 87  Pectobacterium atrose...
Q8FDF5  88 LGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSP 167 Escherichia coli CFT073
Q6D6Y6  88 LGGYGIFNVGHRNPNVIAAVESQLARQPLHSQELLDPLRGLLAKTLAALTPGNLKYSFFSNSGTESVEAALKLAKAYQSP 167 Pectobacterium atrose...
Q8FDF5 168 RGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMLTALNECKKTGDDVAAVILEPIQGEGGVI 247 Escherichia coli CFT073
Q6D6Y6 168 RGKYTFIAATGAFHGKSLGALSATAKPAFRRPFMPLLPGFHHVAFGDISAMRKQVQQCQKTGDDVAAIILEPIQGEGGVI 247 Pectobacterium atrose...
Q8FDF5 248 LPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPF 327 Escherichia coli CFT073
Q6D6Y6 248 VPPENYLPAVRALCDEVGALLILDEVQTGMGRTGKMFACEHYGVQPDILCLAKALGGGVMPIGATVATEAVFSVLFENPF 327 Pectobacterium atrose...
Q8FDF5 328 LHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASE 407 Escherichia coli CFT073
Q6D6Y6 328 LHTTTFGGNPLACAAALATVNELLTKNLPEQAAIQGEFLLQGLQQLAAEYPQLIIEARGMGLLQAIEFRKNEIGYAFAKE 407 Pectobacterium atrose...
Q8FDF5 408 MFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKAL 449 Escherichia coli CFT073
Q6D6Y6 408 LFQRNILVAGTLNNSKSVRIEPPLTITREQCARVLKEAKDVL 449 Pectobacterium atrosepticum SCRI1043
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap