Conserved Protein Domain Family
cellulose_yhjU

?
TIGR03368: cellulose_yhjU 
cellulose synthase operon protein YhjU
This protein was identified by the partial phylogenetic profiling algorithm () as part of the system for cellulose biosynthesis in bacteria, and in fact is found in cellulose biosynthesis gene regions. The protein was designated YhjU in Salmonella enteritidis, where disruption of its gene disrupts cellulose biosynthesis and biofilm formation (). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 132411
View PSSM: TIGR03368
Aligned: 12 rows
Threshold Bit Score: 745.313
Threshold Setting Gi: 499448756
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000192026  22 SGWNFYFLVKFGLLWAGYLNFHPLLNLVFMAFLLM--PI--PKYRLHRLRHWIAIPVGFALFWHDTWLPGPQSIMSQGTQ 97  Salmonella ente...
WP_000191567  22 SGWNFYFLVKFGLLWAGYLNFHPLLNLVFAAFLLM--PI--PRYSLHRLRHWIALPIGFALFWHDTWLPGPESIMSQGSQ 97  Escherichia coli
WP_011263705  14 GWWNIYFIIKIGLFLQGIIDFHPIENFALVAFLLI--PI--RHKILNVIRQFLAVPFGLWLMHYDSFLPPLDRLWSQMGQ 89  Aliivibrio fisc...
WP_011095827  21 GAWNLYFLLKFALLWFGYLNFHPLLNLVFLAFLLF--PI--PNVTLHRWRHIIAIPLGIGLFYHDTWLPGINSILSQGTQ 96  Pectobacterium ...
WP_011218432  16 GWWNVYFIIKIALFLKGDISFHAIENFAFISFLLL--PI--SLKWLSITRTFISIPVGLWLLHFDSYLPPLDRLWSQIEQ 91  Photobacterium ...
WP_011299645   2 GIWNLYFIVKLYLFHIGRVEPQWLLNILFALALAI--RI--PNRALAALRQVVAVVAGAALLYWEANLPPFERAISQFSN 77  Cupriavidus pin...
WP_011545168   2 TFWNLYFILKFALFATGRLQPFWLANLAFAVALVAsaPI--RSRAWRIVRQVVAVAIAVPLLARELHAPSLARLAEAARE 79  Burkholderia ce...
WP_011328815   7 GIWNLYFLVKFVLFYYGAIKFDFLSNAALAALFAL--TF--SNSQVDKLKHFIGAVFAIVLLYKDSWLPPIDRLTKQAGN 82  Pseudoalteromon...
WP_011516959   2 GLWNLYFLAKIYLFHTGQMQPIWLLNLVFALLLVI--PL--ESRILRVLRQIIAIGAGAALAWRESTLPPFTRLLTEFSN 77  Cupriavidus met...
WP_010953552  18 GGWNLYFFAKFLLVALGMLDFQALPNLLFAAFLLV--PL--PGKWLRIARQLLAVPIGIALFYQDTWLPPFSRLLAQPG- 92  Pseudomonas putida
WP_004187271   2 TFWNLYFILKLYLFAAGHLKPLWIANLGFALALAL--SApaRRRSVRLLRHALALALAVPLMYREADVPPLARLVETLGG 79  pseudomallei group
WP_011136220  20 GGWSLYFILKLLLAWRGALSAHPAPDLAFALVLLL--PL--RRRWLRLARDALAWPAAAILLYYDSWLPPPAALWRELSE 95  Chromobacterium...
WP_000192026  98 VAEFSSGYLLDLIARFINWQMIGAIFVLLVAWLFLSQWIRVTVFVVAIMVWL----------NvltltgpvftLWPAGQP 167 Salmonella ente...
WP_000191567  98 VAGFSTDYLIDLVTRFINWQMIGAIFVLFVAWLFLSQWIRITVFVVAILLWLnvltlagpsfS----------LWPAGQP 167 Escherichia coli
WP_011263705  90 LLQFNLSYLIELASRFVSLETLLGLFVLVFAYYFLNQIFRISVFVVITLIAI----------S----------LPSDLFS 149 Aliivibrio fisc...
WP_011095827  97 VVGFSSAYLLELLNRFINWQMIGAAVVITVAYLFFAQWIRITVFTVAALAWL----------N----------IVNLAGP 156 Pectobacterium ...
WP_011218432  92 LMQFELSYLIELAGRFISLTTLLTIFTLSAAYYLLNKYIRVTVLVLISLIYI----------S----------VPQSIIT 151 Photobacterium ...
WP_011299645  78 LQAFTPAYMVELLGRLVSREMLLTALAVLVVFLLVNRWVRVTTLVFAALVLV----------P----------LWQVLS- 136 Cupriavidus pin...
WP_011545168  80 VSTFRLDYWMELLPRLLPPVLALTIVGVLIVYFIVNRWLRVATFVVAVLVVM----------P----------LWQAGSG 139 Burkholderia ce...
WP_011328815  83 IQDFSLGYFVELFGRIVNYDMLLGLFIIVICFWYTSQWIRFTTVTIAGLIFI----------G----------YQGALKP 142 Pseudoalteromon...
WP_011516959  78 IRAFTPGYLVELFQRFVPVQMVVAVVLVVLVYLLINRWIRTTTLVLLALIAM----------P----------IWYGTGI 137 Cupriavidus met...
WP_010953552  93 VLDFSWDYLLELLGRFINWNLLGALAMLLVGYLYLRHWLRLSTLSLLGLAWL----------S----------V-GGLPS 151 Pseudomonas putida
WP_004187271  80 LRAFSAGYWMELVPRFVPPMLALAALGVVIGYLIVNRWLRVATFVLLALIAL----------P----------VWQAGSA 139 pseudomallei group
WP_011136220  96 LKGFSLSYLMELAGRILTPTLLIGFTVVLAGYLLLSRFLRLGTLVMATLLAL----------Sah-------eLWQQRAP 158 Chromobacterium...
WP_000192026 168 -Td-----tVTTTGGNAAATVATAGDkpvi--gdmpA---Q--------TAPPTTANLNAWLNTFYAAEEKRKTTFPAQL 228 Salmonella ente...
WP_000191567 168 -T-------TTVTTTGGNAAATVAATggapvvgdipA---Q--------TAPPTTANLNAWLNNFYNAEAKRKSIFPSSL 228 Escherichia coli
WP_011263705 150 -S-------QPNTVANVSQQPESAET----------A---QisdhqvdeTGPVNDAVLNNAKELFFRNEAQRRVSFPTTS 208 Aliivibrio fisc...
WP_011095827 157 -AislmpaaLTTPAPSVAASPKDGGA----------AlpeA--------TLPPTNANLTAYLNQFYTREKARTTVFPATL 217 Pectobacterium ...
WP_011218432 152 -Tpni--nnTPSLLAQQQTTDQNEKE----------KhplQ--------ISEVNDDVLNDFRNNFFADEAKRVTNFNNNT 210 Photobacterium ...
WP_011299645 137 -V-------GPVVGGGQQAIAGTETA----------A---A--------GSAPGEAGWDARLNAFRQQEAQRSVHFGPLA 187 Cupriavidus pin...
WP_011545168 140 -L-------MARVVAPAQPQANVAGA----------T---R--------VDQPEDH--NAALATFRAQESQRQVAFGHLG 188 Burkholderia ce...
WP_011328815 143 nD-------MAVSVQNAPNQEQEFSN----------T---A--------VVTQKLDSADQQLNDFYKQQSQLVSYFPDEY 194 Pseudoalteromon...
WP_011516959 138 -T-------LPG-AKAQQATAQSAGS----------A---R--------ADINATNNYDAILAAFRQQETQRTATFSPLT 187 Cupriavidus met...
WP_010953552 152 -L-------VAGQAPGVAARTAAEPA----------P---A--------TAAADNATLDSWLERFFASERERVTAFPAVS 202 Pseudomonas putida
WP_004187271 140 -A-------LARLDAAAAAVPGPAGT----------G---R--------AVQPQDH--NAALAAFRSQESQRQVTFGRPS 188 pseudomallei group
WP_011136220 159 -A-------ASASSA--------FGG----------A---------------PSAQTPDQRLEGFFRSEQRRQVGFQGPL 197 Chromobacterium...
WP_000192026 229 PPDAQPFDLLVINICSLSWSDVEAAGLMSHPLWSHFDILFKHFNSGTSYSGPAAIRLLRASCGQPSHTRLYQ-PA-NNEC 306 Salmonella ente...
WP_000191567 229 PADAQPFELLVINICSLSWSDIEAAGLMSHPLWSHFDIEFKNFNSATSYSGPAAIRLLRASCGQTSHTNLYQ-PA-NNDC 306 Escherichia coli
WP_011263705 209 PSTD--FDLLFLSICSVAWDDIEIAGLESHPLFKEFDVMFDNFSAATSYSGPAVIRLLRASCGQESHPELFKaPA-SKQC 285 Aliivibrio fisc...
WP_011095827 218 PQDAQPFDLLIINICSLSWSDLEVAQLENHPLWKKFDILFRQFNSAAAYSGPASIRLLRASCGQQSHTDLYQ-PV-NEQC 295 Pectobacterium ...
WP_011218432 211 QSDA-PFDLLFLSICSVAWDDIKLVGLQNHPIFDDFDIMFDNFNSATSYSGPAVIRLLRANCGQEEHSQLFD-DAaSNQC 288 Photobacterium ...
WP_011299645 188 ATPDTQYDIIVLHICSLSWDDLDVAKARDNPLLSRFDFLFTNFSSAASYSGPAAIRVLRAACGQPQHKDLYD-SA-PAEC 265 Cupriavidus pin...
WP_011545168 189 SDPAAQFDVIVLHICSLSWDDLDAAKVRNHPMLSHFDYLFTNFSTAASYSGPAAIRVLRASCGQEAHADLYK-PA-PQQC 266 Burkholderia ce...
WP_011328815 195 NGT--QFDVVVLNICSLAIADLNAIGVSLDDVYSDFDIVFSDFNSATSYSGPAAIRLLRASCGQTSQPALFD-DA-PEQC 270 Pseudoalteromon...
WP_011516959 188 ATPDAQFDIIVLHICSLSWDDLDAAKSLNHPLLSRFDYLFKNFSSAASYSGPAAIRLLRASCGQQPHKDLYD-PA-PAEC 265 Cupriavidus met...
WP_010953552 203 ADE-QPFDLLVINICSLAWDDLSAVGLRDNPLLSRMDVIFDQFNSATSYSGPAAIRVLRASCGQSSHAGLYQ-PA-PEQC 279 Pseudomonas putida
WP_004187271 189 ADPATQFDVIVLHVCSLSWDDLDVARLRNHPLLGHFDYLFTNFSTAASYSGPAAIRVLRASCGQEAHADLYK-PA-PAQC 266 pseudomallei group
WP_011136220 198 ADPG--FDVLLLHVCSLSWDDLRAVGFDNPPLLARFDIVFDRFNSAASYSGPAALRVLRASCGQPRHSALYE-PA-PEQC 273 Chromobacterium...
WP_000192026 307 YLFDNLAKLGFTQHLMMDHNGEFGGFLKEVRENGGMQ-SELMNQSGLPTALLSFDGSPVYDDLAVLNRWLTGEEREANSR 385 Salmonella ente...
WP_000191567 307 YLFDNLSKLGFTQHLMMGHNGQFGGFLKEVRENGGMQ-SELMDQTNLPVILLGFDGSPVYDDTAVLNRWLDVTEKDKNSR 385 Escherichia coli
WP_011263705 286 FLFDNLAKLGFQENLLLNHDGKFDDFLGLLKEDGDLK-APLMSQAGLTQYQSAFDGSPIYRDKDVLNRWLDKREKSQDGP 364 Aliivibrio fisc...
WP_011095827 296 YLFSNLVTLGFEEQLMLDHSGIFGNYLREVREEGNIQ-IPILSQEGISHQITSFDGEPIYNDLELLNRWLGERDKATTTR 374 Pectobacterium ...
WP_011218432 289 YLFENLADLGFQENLLMNHDGVFDSFLSLIKKDGKIE-TNLMPQEGLTPYQKGFDGASIFRDKDVLDRWWQERIENDSGQ 367 Photobacterium ...
WP_011299645 266 HIFSALADAGFSTRMLLNHDGHFDNFLQEVEQEVGVPgVKPPSNDGLPVAMRSFDNSPVAGDFDVLQRWYKKRLAEGGGP 345 Cupriavidus pin...
WP_011545168 267 HLFSQLAGAGYTVQSLLNHDGHFDNFLQVIHDNIGVAdAPMISNAAAPVAMHAFDGSAIKDDYATLANWYAQR-ASVPGP 345 Burkholderia ce...
WP_011328815 271 HLFNNLEKLGYDSHLVMNHDGHFDGFKDLVKKQGKLN-SPLFDTTSLPVAQYSFDSKPIYSDEAVLNSWLEEQ-GDSCAP 348 Pseudoalteromon...
WP_011516959 266 HLFADLAQAGFTPRILMNHDGRFDNFRTYVETEIGIQgVKMESTEGVPVAMRAFDDSPILDDFNTFDHWYKQHLAQDKGP 345 Cupriavidus met...
WP_010953552 280 LLFQNLARLGFQSNTLLNHSGRFDNFIGDITQQ-RMP-QPGMRNTDFPRALVGFDGSPIASDLDVLRRWWGQRKGTPDEH 357 Pseudomonas putida
WP_004187271 267 HLFGQLAAAGFAPQTLLNHDGHFDNFLQLIRENIGVPnAPMIPNADAPVAMHAFDGSAIKDDYATLANWYAKR-GASPGP 345 pseudomallei group
WP_011136220 274 FLFENLAKAGFKTELSLNHDGSFDSFLQQIRRNGRMN-LPLTPQDGVAVGQRGFDSSPIYSDYAMLNRWLQLRLQEPDPH 352 Chromobacterium...
WP_000192026 386 SATFFNLLPLHDGNHFP---GVSKTADYKIRAQKLFDELDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQISGLRDIPS 462 Salmonella ente...
WP_000191567 386 SATFYNTLPLHDGNHYP---GVSKTADYKARAQKFFDELDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQVSGLRDIPS 462 Escherichia coli
WP_011263705 365 TVALYNTISLHDGNRIIkasGKVGLVSYKLRLKNLLDDLYDFFQELKASNRNIVVMLVPEHGAGMRGDKMQIAGMREIPS 444 Aliivibrio fisc...
WP_011095827 375 NATFFNLLPLHDGNRFV---GSNQSADYAPRAKILFDQLDAFFDVLQKSGRKVMVIVVPEHGAALAGDKMQMSGLRDIPS 451 Pectobacterium ...
WP_011218432 368 VVALYNTISLHDGNRIInnnASTSLISYKRRLNNLLDDLYSFFNELKASERNIVVMLVPEHGAGMRGDKMQISGMREIPA 447 Photobacterium ...
WP_011299645 346 QALYYNTVTLHDGNRLPd-tKMSSLESYPLRLSKLLGDVDKVIDMVASSGRKAVIVFVPEHGAALRGDANQIAGMREIPT 424 Cupriavidus pin...
WP_011545168 346 VALYYNTISLHDGNRVVg-sALTSIDSYPQRATKMMTDFDRLADLIAQSGRRAVIVFVPEHGAALRGDKNQIAGLREIPT 424 Burkholderia ce...
WP_011328815 349 CAMYYNTISLHDGNQLAnsrRMNSDESYPVRQQNLFSDINQFIKNLEKRGRNVMLMLVPEHGAALQGDKVQFAGLREIPS 428 Pseudoalteromon...
WP_011516959 346 VALYYNTVTLHDGNRLPd-kRLTSIESYPLRLKTLLDDVDRIIDTISKSGRKAVVIFVPEHGAALRGDKNQISGLREIPT 424 Cupriavidus met...
WP_010953552 358 VSLFYNSISLHDGNRIVtadGGTRVADYATRANRLFGELGTFLDELEGSGRRVVVAIVPEHGAALHGDRMQLSGMREIPT 437 Pseudomonas putida
WP_004187271 346 VALYYNTISLHDGNQLTg-gRMSSLDSYPLRARKLLDDFDRFADLIAASGRRAVIVFVPEHGAALRGDAKQVAGLREIPT 424 pseudomallei group
WP_011136220 353 VAVYYNTISLHDGNRIPeapALDTDASYKYRAGRLLRDIGQFIDLLEQDHRKMILLLVPEHGAALRGDKQQFSGLREIPS 432 Chromobacterium...
WP_000192026 463 PSITNVPAGVKFFGM--KAPHEGAPIDINQPSSYLAISELVVRAVDGKLFTEDSVNWNKLTSNLPQTAPVSENANAVVIQ 540 Salmonella ente...
WP_000191567 463 PSITDVPVGVKFFGM--KAPHQGAPIVIDQPSSFLAISDLVVRVLDGKIFSEDNVDWKKLTSGLPQTAPVSENSNAVVIQ 540 Escherichia coli
WP_011263705 445 ATIVHTPVGMKIFGQ--GMTRLGSTAHISAPSSYLAVSTLVSRIIEEDIYATKTFNTAELVKDLPTTKMVAQNSGTTVME 522 Aliivibrio fisc...
WP_011095827 452 PSITHVPVGVKMFGL--QAPHQGDTLEITSPSSHMAISELVARMVDGKVFTAPSVDWQALTSALPQTEAISENENSIVMQ 529 Pectobacterium ...
WP_011218432 448 PSITHVPVGLKVFGK--NIERTGKNVHITAPSSYLAISSLVSNILDQNIYELATFDPEKLVINLPETSVVAENSGTTVMD 525 Photobacterium ...
WP_011299645 425 PRIIHVPVGVKLVGLpeGQSPSGKTVTIDTPTSYLALSQLISNLVAENPFQPGAQTLDQYAADLPQTQMVGENEVTVTMR 504 Cupriavidus pin...
WP_011545168 425 PRIVHGPVGVRLVGF---TGNHGATTVIEQPTSFLALAQLLSNLVSNSPFKPGA-TLAQYAADLPRTRMIGENEGTVTMQ 500 Burkholderia ce...
WP_011328815 429 PSIVTVPAAIKFIGP--DLPRM-SQITVANTSSYFALSELITKVMKSNYFAGKSNNMAELVSQLPTSQKVAENAGTIMMY 505 Pseudoalteromon...
WP_011516959 425 PNIIHVPVGVKLVGL--PTTATPQPVTIDAPTSFFGLSQLVFNLVADSPFRQGAPDLAHYVEDLPQTQMVGENEATLTMK 502 Cupriavidus met...
WP_010953552 438 PSITHVPVGLKFIGM--GQPARNEPLRVTAATSYLALSELISRVYAG-LGQQQVLDVPGLLTDLPTTEQVAETSGAQVLN 514 Pseudomonas putida
WP_004187271 425 PRIVHGPVGVRLVGF--K-GDHGATTVIDAPASFFALAQLLANLVSNSPFKPG-VTLSQYAADLPQTRMIGENEGTVTMT 500 pseudomallei group
WP_011136220 433 PLITTVPAAIKVIGS--Q--GRPAQYRVTQQASYTAIATILSRMLARSPFGAD-YQPESYAQDLPATPFVSENANFTVMQ 507 Chromobacterium...
WP_000192026 541 YQGKPYVRLNGG-DWVPY 557 Salmonella enterica
WP_000191567 541 YQDKPYVRLNGG-DWVPY 557 Escherichia coli
WP_011263705 523 YNKKPYVSLDGT-TWSEY 539 Aliivibrio fischeri
WP_011095827 530 YQGKPYIRLNGG-DWVPY 546 Pectobacterium atrosepticum
WP_011218432 526 INNKHYISLDGN-TWSEY 542 Photobacterium profundum
WP_011299645 505 DGSGYMVHTPDG-VWIEg 521 Cupriavidus pinatubonensis
WP_011545168 501 TAAGYAVKTPDG-VWIDE 517 Burkholderia cenocepacia
WP_011328815 506 VNKRPYIQLDGG-EWTLY 522 Pseudoalteromonas haloplanktis
WP_011516959 503 RTNGYVIHTPDG-VWVEQ 519 Cupriavidus metallidurans
WP_010953552 515 YQGRAYMRLQGQpDWQPI 532 Pseudomonas putida
WP_004187271 501 TPTGYAVKTPDG-VWIDE 517 pseudomallei group
WP_011136220 508 SGSRYLMQSSGG-NWNDY 524 Chromobacterium violaceum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap