Conserved Protein Domain Family
VI_minor_1

?
TIGR03360: VI_minor_1 
type VI secretion-associated protein, VC_A0118 family
Members of this protein family, including VC_A0118 from Vibrio cholerae El Tor N16961, are restricted to a subset of bacteria with the type VI secretion system, and are encoded among the type VI-associated pathogenicity islands. However, many species with type VI secretion lack a member of this family. This lack suggests that members of this family may be targets rather than components of the type VI secretion system.
Statistics
?
PSSM-Id: 132403
View PSSM: TIGR03360
Aligned: 6 rows
Threshold Bit Score: 233.57
Threshold Setting Gi: 499407475
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000088598  54 AMQSCRQETAALERLDCYDRILA-PEQ--AgfggAaLVKARYQGETWARATEQEKRRQGNTTELLVTQVPGERPTVVITT 130 Escherichia coli
EIR60905      35 LVMRCRSENSALVRLDCYDKALS-PVN--A----V-DEKRVNAGPAWQRAMNQEKGRTDHSTAFLVTEGEGSNPMVLITT 106 Yersinia pestis...
WP_010954865  24 ASPDCPRIVSNIERLACFDQAAGtPGFtpQ----RqWSAQELEAPTVRRVLIHETGRAPEDLRFRLRSEEGG---LLISA 96  Pseudomonas putida
WP_001223387  33 QAELCREIPARLERLACFDRVFAtPLE--Q----VaIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIAL 106 Vibrio cholerae
WP_011705723  24 RWQACRQEPSPLVRLACYDAIGN--GA--A----SaAEGAAPKSAAWQAIWAQEQARTPASAPFLLQSNAGSGSETLTRP 95  Aeromonas hydro...
WP_011094942  23 LWEQCRNETTSELRLACYDALG--------------------REAERTGTLSPQGDRATTSGAFQLGREADSDDMTLTRV 82  Pectobacterium ...
WP_000088598 131 PAI----GHVPPrPVLMFSCVDNITRMQVALMHPLDVHDIAVTLNA----D-SRALRSHWFVRENGTLLESSRGLSGIDE 201 Escherichia coli
EIR60905     107 PAI----GMPPPrPVLMLSCIDNITRLQIALVGPQKESSVTLIIDKagiiD-KTRLDAQWFLRENGYLLESSRGLAGIDE 181 Yersinia pestis...
WP_010954865  97 PAI----ASVAPhPYLIISCVQNISRLQLVTAQPVDASRVQVRLRG----ErGATVPTPWQVMENGQVLDAGRGLPGIEQ 168 Pseudomonas putida
WP_001223387 107 PAQnrssGETSP-PVLLLSCINNLSRIELALPKEVADARIQVSIRH----E-----TQFWRSDDHGVLFSSARGMPAIEM 176 Vibrio cholerae
WP_011705723  96 ALR----GAT-----LAIGCVDSITHIRLRLDSPWSGEKVQVELDG----Q-PSAGSQSWFIRDQGLLLEYGRGLPAIEE 161 Aeromonas hydro...
WP_011094942  83 LAD----GNT-----LVISCASNITHLRLTLSEPWAGESVTSQLDG----V---TVSDSWFIRNRGLLLESGRGLPAIDT 146 Pectobacterium ...
WP_000088598 202 IKQLFGAKTLTVDtGTDNAAGKLTFNIDGLARVIAPLRDACHW 244 Escherichia coli
EIR60905     182 IKRLMSAETLTIE-GANGAFPRLTFTLSQLTPALKPLRNACHW 223 Yersinia pestis PY-25
WP_010954865 169 IKQLIGAHRIHVE-SDNPAVDGLVFDAQGLDPLIDEARKTCRW 210 Pseudomonas putida
WP_001223387 177 MKLAASESRLLLR-SNAPFADGLQFDTRGVNEALDALRERCGW 218 Vibrio cholerae
WP_011705723 162 LKRWQGHRELQVR-ADNGAL--LRVDLSGLKEALTPLRQQCRW 201 Aeromonas hydrophila
WP_011094942 147 LKRWIGHRELVLN-GTDGHA--LRIELTGLGEALAPLRQQCHW 186 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap