Conserved Protein Domain Family
VI_chp_5

?
TIGR03358: VI_chp_5 
type VI secretion protein, VC_A0107 family
Work by Mougous, et al. (2006), describes IAHP-related loci as a type VI secretion system (). This protein family is associated with type VI secretion loci, although not treated explicitly by Mougous, et al. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 132401
View PSSM: TIGR03358
Aligned: 18 rows
Threshold Bit Score: 173.617
Threshold Setting Gi: 488686304
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010910843   8 KVIERNRAPRVQIAYDVETYGSPTTIELPFVMAVMADLSGASQtkEASKSVLDRNFVETDANRFPKFMEAMGPRVKARVK 87  Mesorhizobium loti
AHK04542       6 EKLERVRKPRVHIKYEVETEGAMVVKELPFVVGVLGDFSGNPT--QPLKPFGERKFVQIDRDNFDEVMRRMTPGLNISVA 83  Agrobacterium t...
CDH71688      20 HKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPD--TPPAKLVERRFVDIDRDNFNEILSSISPRATLQVD 97  Pseudomonas aer...
WP_011115092   2 AENSTPPKERINITYRSKTNGQNPDVELPLKLMVMGNFTGGN-----DVPFDEREVVSINKHNFNQVMQKMNIGTHVSVK 76  Helicobacter he...
AHX36811      22 KEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGH----AEQTPLEERATVTVDKNNFEAVMRESELKITATVK 97  Vibrio cholerae
WP_011146549   5 RKLDKVRPPRVQITYDVELGGAVEKKELPLVIGVIGQFA------EQSIPMRERRFMQVDKDNFNAVMEGLSPSLELQVE 78  Photorhabdus lu...
WP_011515482   4 SFQNEVPKARVNIKLDLHTGGAQKKVELPLKLLVMGDYSNG----QETRALAEREKVSINKNNFNSVLADFNPKARIAVE 79  Cupriavidus met...
WP_005418723   3 KDGSVAPKERVNVTFKPVSGDAAEDLELPLKMMVLGDFTQQ----EDDRKLEDRKPFNVDKSNFNDVIEKQNLNISFGVK 78  Aliivibrio fisc...
WP_012599991  24 NGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKP----DNTPLDERTAIAINRYNLNAVISEADIEREFVVP 99  Escherichia coli
WP_010943792   3 NEASVAPKERVNIVYRPADGEGREEVELPLKILVLGDFTGQPD--E--RPVEKRDPVPVDKENFSEVMKAQRIMLNIAVS 78  Geobacter sulfu...
WP_010910843  88 NTLPQAegaerD-E---ELAIDLTFSKMGDFAPDKVAEQVPQLAEILKMRRQLEELLGFMDGRVDAEKRIAQLLNN-EPL 162 Mesorhizobium loti
AHK04542      84 NTLQKD-----G-T---DMQVNLKFESMDDFEPGAVVQQVPALKALLDARNELRDLLSKADRSEDLERMLEDILQN-KTD 153 Agrobacterium t...
CDH71688      98 NTISGD-----D-S---KLNVELRFNHIEDFDPVNLVKQVVPLRRLFEARQRLRDLLTKLDGNDDLDQLLQDVVAN-TEG 167 Pseudomonas aer...
WP_011115092  77 NVLKQD-----A-D---ELSVNLKFEGLGDFSPDSIATQVPELNKLLQLREALVALKGPMGNIPDFRKALLEALKD-KDT 146 Helicobacter he...
AHX36811      98 NKLTDD-----EnA---ELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERLQSLLNS-EES 168 Vibrio cholerae
WP_011146549  79 SALPGQ-----S-G---FMNVDLQFKSMADFTPENLAKQIEPLRHLLEVRGKLSDLKGRALSNEKLRDRLAEILAEhADK 149 Photorhabdus lu...
WP_011515482  80 STLARD-----G-S---ELPVDLDFKSMDDFKPEVVASRVPELRALMAARNLLRDLKSNLLDNAMFRRELEKILKD-PGL 149 Cupriavidus met...
WP_005418723  79 NQLQDD-----G-EgneEIAVDLSFKHINDFDPSSIVEQVPELKGLMDLREALVSLKGPLGNVPAFRKAIEDALVD-DEA 151 Aliivibrio fisc...
WP_012599991 100 AELSDA-----PnE---QMYVNLKVKSMDDLSPDHIASQVPEIKRLLELREALVALKSPLGNIPAFRAQLQALLEN-EDT 170 Escherichia coli
WP_010943792  79 NRLYDA-----PdE---ELPVKLKMESLRDFGPEAIVEQVPEMKRLLELREALRALKAPLSNIPDFRRKIQELVTD-DAA 149 Geobacter sulfu...
WP_010910843 163 LSKIASQAISD 173 Mesorhizobium loti
AHK04542     154 LATLVSELKEK 164 Agrobacterium tumefaciens LBA4213 (Ach5)
CDH71688     168 LQEIKaarpea 178 Pseudomonas aeruginosa MH38
WP_011115092 147 KEKLLLEIKEN 157 Helicobacter hepaticus
AHX36811     169 REKLLAELNLL 179 Vibrio cholerae
WP_011146549 150 LPQANEEAETA 160 Photorhabdus luminescens
WP_011515482 150 SERLRADLQKi 160 Cupriavidus metallidurans
WP_005418723 152 REKLLSELGLv 162 Aliivibrio fischeri
WP_012599991 171 REQLIQELGIA 181 Escherichia coli
WP_010943792 150 RAKLLAEIGIE 160 Geobacter sulfurreducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap