2OG1


Conserved Protein Domain Family
biphenyl_bphD

?
TIGR03343: biphenyl_bphD 
Click on image for an interactive view with Cn3D
2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
Members of this family are 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase, or HOPD hydrolase, the BphD protein of biphenyl degradation. BphD acts on the product of ring meta-cleavage by BphC. Many species carrying bphC and bphD are capable of degrading polychlorinated biphenyls as well as biphenyl itself.
Statistics
?
PSSM-Id: 132386
View PSSM: TIGR03343
Aligned: 4 rows
Threshold Bit Score: 575.328
Threshold Setting Gi: 21624259
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2OG1_A     4 LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMD 83  Pseudomonas sp.
BAC01057   4 LNESTTSKFVTINEKGLSNFRIHLNDAGEGEAVIMLHGGGPGAGGWSNYYRNIGPFVKAGYRVILQDAPGFNKSDTVVMD 83  Comamonas testosteroni
AAB57641   4 YTEADTSNYLVIDEPGLSNFRLHYNEAGQGEAVIMLHGGGPGASGWSNYYKNIEALADAGFRVILLDCPGFNKTDEVVTD 83  Pseudomonas nitrore...
P47229     4 LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMD 83  Burkholderia xenovo...
2OG1_A    84 EQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEP 163 Pseudomonas sp.
BAC01057  84 EQRGLVNARSVKGMMDVLGIEKAHLVGNSMGGAGALNFALEYPERTGKLILMGPGGLGNSLFTAMPMEGIKLLFKLYAEP 163 Comamonas testosteroni
AAB57641  84 TQRGLLNARAVKGLMDGLSIEKAHLVGNSMGGATALNFALEFPDRLDRLVLMGPAGMGKSLLQPNP-QKLRHMFRLYSDP 162 Pseudomonas nitrore...
P47229    84 EQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEP 163 Burkholderia xenovo...
2OG1_A   164 SYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLD 243 Pseudomonas sp.
BAC01057 164 SLDTLKQMLNVFLFDQSLITDELVQGRWANIQRNPEHLKNFLLSSQKLPLSSWNVSPRMGEIKAKTLVTWGRDDRFVPLD 243 Comamonas testosteroni
AAB57641 163 TPENFAEMLNVFVFDPSAITEELRQNRWNNILSRPGHLKNFVASSKLTPVTAWDVVDQVHKIPNKTLVTWGRDDRFVPLD 242 Pseudomonas nitrore...
P47229   164 SYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLD 243 Burkholderia xenovo...
2OG1_A   244 HGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRH 285 Pseudomonas sp.
BAC01057 244 HGLKLVANMPDAQLHVFPRCGHWAQWEHADAFNRLTLDFLAN 285 Comamonas testosteroni
AAB57641 243 NGLKLINFMPDAQLHVFSRCGHWAQWEHADAFNRLVIDFLRN 284 Pseudomonas nitroreducens
P47229   244 HGLKLLWNIDDARLHVFSKCGHWAQWEHADEFNRLVIDFLRH 285 Burkholderia xenovorans LB400
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap