Conserved Protein Domain Family
YhgI_GntY

?
TIGR03341: YhgI_GntY 
IscR-regulated protein YhgI
IscR (TIGR02010) is an iron-sulfur cluster-binding transcriptional regulator (see Genome Property GenProp0138). Members of this protein family include YhgI, whose expression is under control of IscR, and show sequence similarity to IscA, a known protein of iron-sulfur cluster biosynthesis. These two lines of evidence strongly suggest a role as an iron-sulfur cluster biosynthesis protein. An older study designated this protein GntY and suggested a role for it and for the product of an adjacent gene, based on complementation studies, in gluconate utilization. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 132384
View PSSM: TIGR03341
Aligned: 16 rows
Threshold Bit Score: 344.305
Threshold Setting Gi: 499839920
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011514512  62 ITITEAAQGYLADLLSKQDtD-GIGVRIFVEHPGTPRAECCMAYNQPGEEDSADLKFSYDNFSAFIEAASVPYLEDAVID 140 Psychrobacter c...
WP_011576918   2 ISISDTAQAHFCKLLEKQE-P-DTNIRVFVVNPGTPSAECGVSYCPPDAVESTDTTLEFNGFDAVVDAESAPFLSEAEID 79  Pseudoalteromon...
WP_011233510   2 IRISEAAQSHFKKLLADQP-D-GTCIRVFVVNPGMANAECGVSYCPPDSVEPDDERLPFNGFDAVVDSGSAPFLEDAAID 79  Idiomarina loih...
WP_011041094   2 ITISENAQQHFIKLLSQQA-E-GTHIRVFVVNPGTAKAECGVSYCPPDAVEADDIQLPFEGFSAMVDADSKGFLEDAEID 79  Colwellia psych...
WP_011329488   2 ISISETAQAHFAKLLADQA-Q-QTNIRVFVVNPGTSQAECGVSYCPEDAVEDSDIRLNFNGFDGVVDAESAPFLEDAEID 79  Pseudoalteromon...
WP_003088034   4 ITITEAAQAYLAELLEKQStP-GIGIRIFITQPGTQYAETCIAYCKPGEEKVEDTAIALKDFTAWIDAVSEPFLEDAVVD 82  Pseudomonas
WP_011396413   2 VTVTESARDYLAQLLEKQKtE-GMGVRMFVTQPGTKYAETCLAYCKPEEIIKDDEKVEFDAFTLYLDKNSLPYLEEALVD 80  Hahella chejuensis
WP_011507186   5 IQITDNAQEYLAELLAKQNvE-GIAVRIFITQPGTPYAETCLAYCRPGEEEPSDERLDLDKITVYLEKNSIAFLEEAVVD 83  Chromohalobacte...
WP_011588473   7 IDITETAQDYLRDLLSKQD-QaEIGVRIFVERPGTPHAECCMAYCPEGEQEESDVRYDYEGFHAWIEGKSVRYLEDAVID 85  Alcanivorax bor...
WP_004921688  17 LLITPSAQEYLGDLLEKQNtP-GIGVRIFVENPGTPRAECCMAYSAPDEVNPADYKQEYSDFPAYIDAPSIPYLLDAVID 95  Acinetobacter
WP_011514512 141 YNKDRFGGQLTFRAPNSKVPKVGADASVEERINYVLQSEINPSLAAHGGDVQLLELIDEEgvglTAVLKFGGGCQGCSAV 220 Psychrobacter c...
WP_011576918  80 FVTDQMGSQLTLKAPNAKARKVDDDAPLEERINYMIEAEINPQLASHGGKVMLMEITEKG----EAILQFGGGCNGCSMV 155 Pseudoalteromon...
WP_011233510  80 FEEQEMGSQLTLKAPNAKARKVADDAPLIERVEYVIQAEINPQLASHGGQVMISEITDDG----VAILQFGGGCNGCSMI 155 Idiomarina loih...
WP_011041094  80 FTTDQMGSQLTLKAPNAKLRKVADDAPLFERVHYFLQAEVNPQLAGHGGECTLVEITDDG----YAVLQFGGGCNGCAQI 155 Colwellia psych...
WP_011329488  80 FVTDKMGTQLTLKAPNAKARKISGDASLNERVQHMLETEVNPQLANHGGQVSLVEITAAG----IAVLQFGGGCNGCSMI 155 Pseudoalteromon...
WP_003088034  83 YATDRMGGQLTIKAPNAKVPMVNEDSPITERINYYLQTEINPGLASHGGQVSLVDVVEDN----IAVLRFGGGCQGCGMV 158 Pseudomonas
WP_011396413  81 FNTERMGGQLTIKAPNAKMPKVDESSPLPDRINYILYTEINPGLASHGGEVSLVEVVDD-----VAVLKFGGGCQGCSAV 155 Hahella chejuensis
WP_011507186  84 FNADRMGGQLTIKAPNAKMPKVNADSPLEDRVNYVLYSEINPGLAAHGGEIRLMQLTEEN----VAVLQFGGGCQGCAAV 159 Chromohalobacte...
WP_011588473  86 YKKDSMGGQLTFRAPKSRVPDISEDATIEEKINYVLYAEINPNLAAHGGSVQLLELTDDN----VAVLEFGGGCQGCSVV 161 Alcanivorax bor...
WP_004921688  96 YNKDRFGGQLTFRAPNSKVPRVGPDASIEERITYILQSEINPGLAGHGGNCALVEVQDDPenglTAVLKFGGGCQGCSAI 175 Acinetobacter
WP_011514512 221 DMTLRQGVEVQLKQQIP-ELTQVIDETDHTRTENAYY 256 Psychrobacter cryohalolentis
WP_011576918 156 DVTLKDGIEKQMLAQFSgELTAVKDATEHEAGEHSYY 192 Pseudoalteromonas atlantica
WP_011233510 156 DVTLKNGIEKELLERFPeEVKGVRDITDHEPGEHSYY 192 Idiomarina loihiensis
WP_011041094 156 DVTVKDGIEKQLIELMAgEIKGVKDATEHERGDHSYY 192 Colwellia psychrerythraea
WP_011329488 156 DVTLKEGIEKEMIEKFE-EITGVADITEHQAGDHSYY 191 Pseudoalteromonas haloplanktis
WP_003088034 159 DMTLKDGVEKTLIERIP-ELKGVRDVTDHSNKENAYY 194 Pseudomonas
WP_011396413 156 DFTLKQGVEKTLLSKIP-ELKGVRDATDHTVTDNAYY 191 Hahella chejuensis
WP_011507186 160 DLTLKEGVEKTLIERVP-ELAGIRDVTDHTDDTNAYY 195 Chromohalobacter salexigens
WP_011588473 162 DVTLRDGVEKTLQERIP-ELAGVRDKTDHTVTDNAYY 197 Alcanivorax borkumensis
WP_004921688 176 DVTLKQGVETTLRQQIP-ELQRVVDQTDHTQAEGAYF 211 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap