Conserved Protein Domain Family

TIGR03341: YhgI_GntY 
IscR-regulated protein YhgI
IscR (TIGR02010) is an iron-sulfur cluster-binding transcriptional regulator (see Genome Property GenProp0138). Members of this protein family include YhgI, whose expression is under control of IscR, and show sequence similarity to IscA, a known protein of iron-sulfur cluster biosynthesis. These two lines of evidence strongly suggest a role as an iron-sulfur cluster biosynthesis protein. An older study designated this protein GntY and suggested a role for it and for the product of an adjacent gene, based on complementation studies, in gluconate utilization. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
PSSM-Id: 132384
Aligned: 16 rows
Threshold Bit Score: 344.305
Threshold Setting Gi: 499839920
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011514512 221 DMTLRQGVEVQLKQQIP-ELTQVIDETDHTRTENAYY 256 Psychrobacter cryohalolentis
WP_011576918 156 DVTLKDGIEKQMLAQFSgELTAVKDATEHEAGEHSYY 192 Pseudoalteromonas atlantica
WP_011233510 156 DVTLKNGIEKELLERFPeEVKGVRDITDHEPGEHSYY 192 Idiomarina loihiensis
WP_011041094 156 DVTVKDGIEKQLIELMAgEIKGVKDATEHERGDHSYY 192 Colwellia psychrerythraea
WP_011329488 156 DVTLKEGIEKEMIEKFE-EITGVADITEHQAGDHSYY 191 Pseudoalteromonas haloplanktis
WP_011507186 160 DLTLKEGVEKTLIERVP-ELAGIRDVTDHTDDTNAYY 195 Chromohalobacter salexigens
WP_011588473 162 DVTLRDGVEKTLQERIP-ELAGVRDKTDHTVTDNAYY 197 Alcanivorax borkumensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap