Conserved Protein Domain Family
phn_lysR

?
TIGR03339: phn_lysR 
aminoethylphosphonate catabolism associated LysR family transcriptional regulator
This group of sequences represents a number of related clades with numerous examples of members adjacent to operons for the degradation of 2-aminoethylphosphonate (AEP) in Pseudomonas, Ralstonia, Bordetella and Burkholderia species. These are transcriptional regulators of the LysR family which contain a helix-turn-helix (HTH) domain (pfam00126) and a periplasmic substrate-binding protein-like domain (pfam03466). [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 132382
View PSSM: TIGR03339
Aligned: 7 rows
Threshold Bit Score: 381.775
Threshold Setting Gi: 451753923
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCQ89077      27 QLRAFDAVAREGSFTRAAERLCISQPAVTGHVKALEEHYQVTLFRRTARRIELTEEGSRLVAITRTLFALEEEAEALLDA 106 Pseudomonas aer...
WP_011301626   5 QLKSFFMVARIGSVTQAAKRLGLSQPTITAQIRALEEAYGVELFHRGGRRLALSDAGLTLLPKVETLVQQETEIDFFLRH 84  Cupriavidus pin...
WP_010930839   5 ELKSFHAVARCGTVTKAAAQLGVSQPTVTGQLRQLESRYGVELFHRQGRGLRLSDAGHRLMPLVEKLVQQESEIEFRLRD 84  Bordetella pert...
WP_011336417   5 ELKAFYMVARLGSITLAAKKLGLSQPTVTTQIRNLESQYSVELFYRGGRRLSVSDEGARLLPMVKALLQQEADIEFFLRN 84  Pseudomonas flu...
WP_011546502   4 QLKAFHATVRQGSITRAARHLGVSQPTIAAQIRQVEQVYGVELFYRSGRKLEVTETGIELLPLVEKMIALEAQADIMLRN 83  Burkholderia ce...
WP_010975819   5 QLRAFHNVAVCGGFSRAAEALFLTQPAVSDQVRKLEEEYDVLLFNRNKKQVTLTQAGHQLLEITRRMFDTEQQALDLLSE 84  Sinorhizobium m...
WP_007951543   7 QLKAFHAVAVHGSFTKAAERLYLTQPAISDQVRKLEERFGVLLFHRNKRSVRLTDLGERLLAITQRLFVVEAEAQELLQE 86  Pseudomonas
CCQ89077     107 NRQLVSGRLEVAADGPHLVMPMLARLRASYPGITVNLRLGNAQETLAALLSEHVDVAVLTEVEARPGLFLEELVNSRICA 186 Pseudomonas aer...
WP_011301626  85 SGDLRTGSLRIGATAPYYVLDLIRRFSARYPAIDVTVEMGNSQEMLNALQEYRVDVAMSSNFVDDPRLSRLLLGVDPLVL 164 Cupriavidus pin...
WP_010930839  85 ASDLREGCLRVGATGPFYIMDTVRRYNQRYPAIELSVAIGNSQSMLQALHDYRIDVATSSVAMNNPNLYRRAIAADPLRI 164 Bordetella pert...
WP_011336417  85 SGQVQ-GALRIAATAPYYILDLVKTFRERLPQVEVSVEIGNSQQVLEALEDYRVDVAASSQLLDDARLIRRVLGSDPLVL 163 Pseudomonas flu...
WP_011546502  84 VGGLFEGHLRIGATGPYYIMDAVGRFSSAHPSIALTCRIGNSEEILQALQEFRIDLAVSSQRNDADGLERKVISTDPLVL 163 Burkholderia ce...
WP_010975819  85 SRALRAGTLRIVADAAHHLLHILAAFRQKYPSVQISLRAGNTETVITSLYSYEADIGVLGEVPESREFDIVKLNSTPIIA 164 Sinorhizobium m...
WP_007951543  87 SQALQTGSLILAVDAPVHVLPQIARFCERYPGISVKIETGNTDESLFRLFNYQADLALLGRDVSDERLLCVPLRNDPMVA 166 Pseudomonas
CCQ89077     187 LLPRQHPWCERnEGVPLEELDQQIMVLREPGSITRRTFDRACAEQGVQPRVLLELDSREAVTEAVAAELGVGVVSSLEVG 266 Pseudomonas aer...
WP_011301626 165 VVHRTHPLAGR-TEITPAALAGCRLLMREAGSTTRIATEQMLAEANVVPGSQMEIGSRESIREAVVRNLGVSVIALHEVP 243 Cupriavidus pin...
WP_010930839 165 VVHRDHPLAAR-ASAGLADLAPYALLLREPGSMTRQLTEEALQKAGVAPARVLEIGSRESIRQAILCNLGVSLIPSREVP 243 Bordetella pert...
WP_011336417 164 AVHRNHPLAAH-DHVTLSALAGHTLLMREPGSTTRRLTEELLASAGVSFGPLLEIGSRESIREAVLRNIGISIIARQEVP 242 Pseudomonas flu...
WP_011546502 164 VVHRQHPLARF-ESIDAARLAGVRLLMREEGSVTRRCTETILAAAGVAATSVAEIGSREAIREAILHGVGGSLFPLGEAE 242 Burkholderia ce...
WP_010975819 165 FASTEHPIARR-STVSLEELSGQPLVMRERGSKTRQKLEDFAAAAGVALKPAIEAEGREAVREIVAAGAGVGFVSAAEFG 243 Sinorhizobium m...
WP_007951543 167 FVSRHHPWAER-ESICLEDLDDTPLVLREHGSVTRQTLEEEMARAGFRIRPAIQVEGREAAREAVVVGIGVGVVSAAEFG 245 Pseudomonas
CCQ89077     267 NDPRVRAVPLVGPELTNRHLIGCLEKRRGLRVIRAFLELA 306 Pseudomonas aeruginosa 18A
WP_011301626 244 SHADLRVLHFTGGSPQLHEYMYCLRERRQARLIDAFVSLA 283 Cupriavidus pinatubonensis
WP_010930839 244 AQAELATVAIADTEVLMHEYLYCLRERQPVQLIARFLELA 283 Bordetella pertussis
WP_011336417 243 HDPQLRVLTLENA-PQIPEYLYCLKERKNARLPAAFLGLA 281 Pseudomonas fluorescens
WP_011546502 243 RHPDLRVIALRGVDTTIDEYVYYLKARRQSPAIDAFLACI 282 Burkholderia cenocepacia
WP_010975819 244 RDGRLAPIEIVGAEMLMDEALICLKERSGGKLVRAFFEIA 283 Sinorhizobium meliloti
WP_007951543 246 ADSRVCALPITDCTRRLTETLVCLREQSSRRVVATFLEMV 285 Pseudomonas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap