Conserved Protein Domain Family

TIGR03339: phn_lysR 
aminoethylphosphonate catabolism associated LysR family transcriptional regulator
This group of sequences represents a number of related clades with numerous examples of members adjacent to operons for the degradation of 2-aminoethylphosphonate (AEP) in Pseudomonas, Ralstonia, Bordetella and Burkholderia species. These are transcriptional regulators of the LysR family which contain a helix-turn-helix (HTH) domain (pfam00126) and a periplasmic substrate-binding protein-like domain (pfam03466). [Regulatory functions, DNA interactions]
PSSM-Id: 132382
Aligned: 7 rows
Threshold Bit Score: 381.775
Threshold Setting Gi: 451753923
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011301626 244 SHADLRVLHFTGGSPQLHEYMYCLRERRQARLIDAFVSLA 283 Cupriavidus pinatubonensis
WP_011336417 243 HDPQLRVLTLENA-PQIPEYLYCLKERKNARLPAAFLGLA 281 Pseudomonas fluorescens
WP_011546502 243 RHPDLRVIALRGVDTTIDEYVYYLKARRQSPAIDAFLACI 282 Burkholderia cenocepacia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap