Conserved Protein Domain Family
phnR_burk

?
TIGR03338: phnR_burk 
phosphonate utilization associated transcriptional regulator
This family of proteins are members of the GntR family (pfam00392) containing an N-terminal helix-turn-helix (HTH) motif. This clade is found adjacent to or inside of operons for the degradation of 2-aminoethylphosphonate (AEP) in Polaromonas, Burkholderia, Ralstonia and Verminephrobacter.
Statistics
?
PSSM-Id: 132381
View PSSM: TIGR03338
Aligned: 6 rows
Threshold Bit Score: 320.178
Threshold Setting Gi: 499619110
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011353594   7 LSAIELLQSQSLAMIVQDMLERAIVSGEYAPGEKLNEVEIATKLNVSRGPVREAFRALEQAGLLRNEKNRGVTVRVVPLR 86  Burkholderia lata
WP_011485563   9 HPTIALLQNSSLTTVVQQEIERAILVGEYEPGSKLIEAALAEKMGVSRGPVREAFRMLEEAGLVRNEKNRGVFVRDIPID 88  Polaromonas sp....
WP_011484128  16 lsplQMLQANTLPSLVQAEIEQMILRSELPGGARINESDLAARFGTSRGPVREALRALEECGLVRSEKNRGVFVREITLA 95  Polaromonas sp....
WP_011301980   2 TDAIQLLRSSSLPMLVQEEIERLIMTGELPPGTRINESDIAARFGTSRGPIREALRALEEAGLVRNEKNRGVFVREISVE 81  Cupriavidus pin...
WP_011491446  31 VDPIEVVRRHSLTTLVRDEIERHIIEGALAPGDKLNEADWATRLQVSRGPVREAFRALEQAGLVRTEKNRGVFVRTVSLA 110 Burkholderia xe...
WP_011299844   8 ASEISILQSQSLTTLVQRELETRIMSGGLVPGAKLNEIEVAGQLNVSRGPVREAFRALEQAGLLRMEKNRGVFVRAISLQ 87  Cupriavidus pin...
WP_011353594  87 EAEEIYEVRAMLDESVARALAKRISPDTLKVLKGIIQSMKDAAKTHDVTRYTELNVQFHDAMVVGVGNTHLTDTYRRLVR 166 Burkholderia lata
WP_011485563  89 EAVEIFDLRAAMDELVGRQLARNITPAQLKEIKGLVDEMEKAVKAEDAYNYHLLNLKFHDRLVEMAGNRKLTAIYRKLIK 168 Polaromonas sp....
WP_011484128  96 EADEIYDLREVLDDMIGRRLAVQITAQQLKVLKNLLAEMDDAMSRQDIKRYHALNLEFHDALVGFAGNSRLSDTYRRLTK 175 Polaromonas sp....
WP_011301980  82 EADEIYELREALEEIIGKRVAQRVNPTLVSELNQLLGAMEDVANKKEAAEYASLNLRFHELLLQHAGSNKLTETYRRLVK 161 Cupriavidus pin...
WP_011491446 111 EADEIYAVRAVLEEAACRMLAASIDARKLAVLRDWLDAMRAALDARDHDAYARANVAFHDALVAASGNLKLYETYRRLVC 190 Burkholderia xe...
WP_011299844  88 EADEIYELRAVLDEHVGRALAAHATAEGVRELRAFIEGLARASTDGDVDAYTRLNLRFHDRMVELTGNGKLVDTYRRLVK 167 Cupriavidus pin...
WP_011353594 167 QLGLLRQAAIeAEEDAIAVSAAEHDKIVQALAGGDGEQAVALVREHLSHGLER 219 Burkholderia lata
WP_011485563 169 ELSLFRRLNL-ADGWLMPISASEHRQIVKAIASGDADIAGRAMFDHVIESKER 220 Polaromonas sp. JS666
WP_011484128 176 ELLLFRLRGL-QDGGGFAVSNAEHKAAVLAIASRDPERAGRTLRAHAADSRAR 227 Polaromonas sp. JS666
WP_011301980 162 ELHLFRMQAL-TQGGGLDVSADEHRAIVDAIVAGNARHAGAALRAHVAASRVR 213 Cupriavidus pinatubonensis
WP_011491446 191 ELSLFRRAALvVHADAMERSLAEHRAILTALASRDAGRAAALMHAHVNGGLQR 243 Burkholderia xenovorans
WP_011299844 168 ELALFRREALsGNSAAMPDSTREHREIVSAIAARDADLAGRLMREHVERGRAR 220 Cupriavidus pinatubonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap