Conserved Protein Domain Family
phnR

?
TIGR03337: phnR 
phosphonate utilization transcriptional regulator PhnR
This family of proteins are members of the GntR family (pfam00392) containing an N-terminal helix-turn-helix (HTH) motif. This clade is found adjacent to or inside of operons for the degradation of 2-aminoethylphosphonate (AEP) in Salmonella, Vibrio Aeromonas hydrophila, Hahella chejuensis and Psychromonas ingrahamii. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 132380
View PSSM: TIGR03337
Aligned: 4 rows
Threshold Bit Score: 396.884
Threshold Setting Gi: 499716190
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011705807  83 PQYLQIKDALANQILAGGLAPNDKLPSERLLGELYGTTRVTIREALVQLEANGLIYREDRRGWFVTPPRFRLNPRRTSNF 162 Aeromonas hydro...
WP_000836268   9 PQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESSGLIWRADRRGWFVTPERLWLDPTQNTNF 88  Salmonella ente...
WP_005463955   1 MQYVKIKDSIVEQIEAGMLSPRQKLPAERKLAESFDTTRVTLREALSLLEAEGRIYREDRRGWFISPEPLRYDPTQTLNF 80  Vibrio parahaem...
WP_011396924   7 NHYRYLQQHFSYLIRQQALLPGEKLPSERDIGERFNLTRMTVRQGLQTLEAEGLIYRQNRRGWFVSPPAVVYNPARRQSF 86  Hahella chejuensis
WP_011705807 163 HQIVREQGGEPRTELLEKSRQAVPPALMVQLQLKPFDSLFLLKRLRYANGRAICYCENHCLPERVPGLLELDLNGSLTEI 242 Aeromonas hydro...
WP_000836268  89 HKLCREQGREPKTALLSGVLTTVPVEVMEPLQLQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNGSLTEV 168 Salmonella ente...
WP_005463955  81 PNMAKAQNRVPKTELIAAKGTLANKQSARLLQLQPFSDVFRVDRVRYLEDRPVVYVTNYIRPEIFPNLLSFDLTNSLTDI 160 Vibrio parahaem...
WP_011396924  87 IEYVSSQGFEPSTDLIGVTVNPADARMAELMKVDKGARLLFLQRRRSIDGRPVLIEHIYINTALLPGIEKEDMSQSLTHL 166 Hahella chejuensis
WP_011705807 243 YQAYYDLHYARMQVRFFPTALPDEVAKALGATAGLPALRLERLNFDQHGRVLDFDLEYWRHDSLEIEVDTQ 313 Aeromonas hydrophila
WP_000836268 169 YESHYNLVYTSMHLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDLDIEYWRHDSLRIEVDTH 239 Salmonella enterica
WP_005463955 161 YREHFGVVYQKTRYRISTSTLLGEVAQALRATSGTPAMVVERTNYNQHGELIDCDIEYWRHDAISIESVAE 231 Vibrio parahaemolyticus
WP_011396924 167 LRNKYGQAYHSMNLIFKSTALLEDAARELGAAAGLPGLHIERTNYDAAGRVLELDYEYWRHDAVTIQIDVN 237 Hahella chejuensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap