Conserved Protein Domain Family
F390_ftsA

?
TIGR03335: F390_ftsA 
coenzyme F390 synthetase
This enzyme, characterized in Methanobacterium thermoautotrophicum and found in several other methanogens, modifies coenzyme F420 by ligation of AMP (or GMP) from ATP (or GTP). On F420, it activates an aromatic hydroxyl group, which is unusual chemistry for an adenylyltransferase. This enzyme name has been attached to numbers of uncharacterized genes likely to instead act as phenylacetate CoA ligase, based on proximity to predicted indolepyruvate ferredoxin oxidoreductase (1.2.7.8) genes. The enzyme acts during transient exposure of the organism to oxygen. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132378
View PSSM: TIGR03335
Aligned: 3 rows
Threshold Bit Score: 918.118
Threshold Setting Gi: 499768455
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010877137   8 YFNPEIETMERGELDALVEERIRYTVNYAYENSPFYSKWFRENNIKPSDIKSHEDLRELPIISGETVRKNQPPEKDRFEF 87  Methanothermoba...
WP_011498732   5 YFNKDIETMERGELDSLVEDKLRYTIDYAVKHSPFYRKWFERNGVSPSSIQSHEDLLELPLVSGELIRKNQPPKTDDFQF 84  Methanococcoide...
WP_011449189   6 FLRPDIETMKYPDLEALIDERIQYTVHYAAEHSPFYKKFFQEHNISPDDIKSHEDLLELPVISGQVIRENQPPVTSDFMF 85  Methanospirillu...
WP_010877137  88 KCAPWEEIYTIHETSGTSGRPKSFFLTWGDWQRYAEKYARSFVSQGFETGDRVVVCASYGMNVGANTMTLAAQKIGMTII 167 Methanothermoba...
WP_011498732  85 MSADWTDIYTIHETSGTSGVPKSFFLTWHDWLRYAKKYGRSFCSQGFGPGDRMVMCASYGMNIGANTMTLAARDVGMAVI 164 Methanococcoide...
WP_011449189  86 KSLDWKDIYTIHETSGTSGTPKSFFLSWDDWKRYAEKYARIFVSQGFTAEDRMIICASYGMNVGANTMTLAAREVGMSII 165 Methanospirillu...
WP_010877137 168 PEGKCTFPVRIMENYRPTGIVANVFKLLRLARRMKEQGIDPRESSIKRLVVGGESFAPESRAYVEELWGVDVYNTYGSTE 247 Methanothermoba...
WP_011498732 165 PEGKCTFPTRIFETYRPTGIVASVFKLLRLARRLKNEGIDPKETSINKLIVGGESFADQSRSYLEEVWGCPVYNTYGSTE 244 Methanococcoide...
WP_011449189 166 PTGKCTFPIRLIQSYQPTGIVGSVFKFLRLARRMKAEGMDPADSSIRRLVVGGESFADESRNYVKELYDCEVYNSYGSTE 245 Methanospirillu...
WP_010877137 248 GTMCGECHIKEGLHVPEDLVHLDVYDPNLRDFVDDGECGRIVLTTLLPVGERTGTLLLNYDTEDTTVVISRDTCRCGRTH 327 Methanothermoba...
WP_011498732 245 GTMCGECVEQNGLHVPEDLVHLDVYDPYRKEFLEDGECGRIVLTTLLSPGEKCGSLLINYDTEDTTVVHSRDKCACGRTH 324 Methanococcoide...
WP_011449189 246 GTMCGECQAVAGLHVPEDIVHLDIHDPRHQRFLPDGEEGHIVLTTLLKPGERCGSLLINYDTDDTTKVISRSRCPCGRTH 325 Methanospirillu...
WP_010877137 328 MRIMNPEREAETFWISGHPFNRVDVEAAVFQRENMDYLTGEYEAFLYGDEdEGTVTMRVSLECEDPGNCAKEIIQENFIG 407 Methanothermoba...
WP_011498732 325 MRIYAPEREAESLWVSGSPFNRVDVEQGVFQRENMDHLTGEYEAFLDKNS-VGKAVLKVNLECLDENNCDRDSIQENFLK 403 Methanococcoide...
WP_011449189 326 MRILNPWREAETIQIFEVPINRIDIERAVFQPENLPSLTGEYEAFVYGEE-ENEITLRISVEAEDKDACSIHDITDVITG 404 Methanospirillu...
WP_010877137 408 AFFKYKRDLHDAYLEGTFEIIFNFVGPGELEFYKVKGRPKRMVDRR 453 Methanothermobacter thermautotrophicus
WP_011498732 404 GFLNPYTGTLNLYEEGGLDVDINFAGMGELEIFKLKGRPKRVVDRR 449 Methanococcoides burtonii
WP_011449189 405 TILKYKPELIGSYDDGIFQILVHITGPGGLELHHIRGRPKRLIDRR 450 Methanospirillum hungatei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap