3FK4,2ZVI,2OEK


Conserved Protein Domain Family
salvage_mtnW

?
TIGR03332: salvage_mtnW 
Click on image for an interactive view with Cn3D
2,3-diketo-5-methylthiopentyl-1-phosphate enolase
Members of this family are the methionine salvage pathway enzyme 2,3-diketo-5-methylthiopentyl-1-phosphate enolase, a homolog of RuBisCO. This protein family seems restricted to Bacillus subtilis and close relatives, where two separate proteins carry the enolase and phosphatase activities that in other species occur in a single protein, MtnC (TIGR01691). [Amino acid biosynthesis, Aspartate family, Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 132375
View PSSM: TIGR03332
Aligned: 7 rows
Threshold Bit Score: 724.701
Threshold Setting Gi: 145580005
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3FK4_A         2 SGIIATYLIHDDsHNLEKKAEQIALGLTIGSWTHLPHLLQEQLKQHKGNVIHVEELAEHEHTNSYLRKKVKRGIIKIEYP 81  Bacillus cereus...
WP_000014200   2 SGIIATYLIHDDsHNLEKKAEQIALGLTIGSWTHLPHLLQEQLKQHKGNVLHVEELAEHEHTNSYLRKKVKRGIIKIEYP 81  Bacillus anthracis
WP_015383506  11 SELLATYLLTEPgADTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEEREGTAASE-------KQAVITIAYP 83  Bacillus subtilis
WP_009328611  11 SELLATYILADPgCDAEKRAEQIAIGLTVGSWTDLPLLKQEQLKKHKGRVVNVEE-TESELGE-------KQATVTIAYP 82  Bacillus
WP_011230454   2 SAVMATYLLHDE-TDIRKKAEGIALGLTIGTWTDLPALEQEQLRKHKGEVVAIEELGESERVNAYFGKRLKRAIVKIAYP 80  Geobacillus kau...
2ZVI_A        22 SELLATYLLTEPgADTEKKAEQIATGLTVGSWTDLPLVKQEQMQKHKGRVIKVEEREGTAASE-------KQAVITIAYP 94  Bacillus subtilis
2OEK_A         2 SAVMATYLLHDE-TDIRKKAEGIALGLTIGTWTDLPALEQEQLRKHKGEVVAIEELGESERVNAYFGKRLKRAIVKIAYP 80  Geobacillus kau...
3FK4_A        82 LLNFSPDLPAILTTTFGKLSLDGEVKLIDLTFSDELKKHFPGPKFGIDGIRNLLQVHDRPLLMSIFKGMIGRNIGYLKTQ 161 Bacillus cereus...
WP_000014200  82 LLNFSPDLPAILTTTFGKLSLDGEVKLIDLTFSDELKKHFPGPKFGIDGIRNLLQVHDRPLLMSIFKGMIGRNIGYLKTQ 161 Bacillus anthracis
WP_015383506  84 EINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQ 163 Bacillus subtilis
WP_009328611  83 EANFTNDIPAVLTTVFGKLSLDGKIKLADLEFSRSFKQSLPGPKFGVYGIRKKIGEFERPLLMSIFKGVIGRDMEDLKEQ 162 Bacillus
WP_011230454  81 TVNFSADLPALLVTTFGKLSLDGEVRLLDLEFPDEWKRQFPGPRFGIDGIRDRVGVHNRPLLMSIFKGMIGRDLAYLTSE 160 Geobacillus kau...
2ZVI_A        95 EINFSQDIPALLTTVFGKLSLDGKIKLIDLHFSEAFKRALPGPKFGVYGIRKLLGEFERPLLMSIFKGVIGRDLSDIKEQ 174 Bacillus subtilis
2OEK_A        81 TVNFSADLPALLVTTFGKLSLDGEVRLLDLEFPDEWKRQFPGPRFGIDGIRDRVGVHNRPLLMSIFKGMIGRDLAYLTSE 160 Geobacillus kau...
3FK4_A       162 LRDQAIGGVDIVKDDEILFENALTPLTKRIVSGKEVLQSVYETYGHKTLYAVNLTGRTFDLKENAKRAVQAGADILLFNV 241 Bacillus cereus...
WP_000014200 162 LRDQAIGGVDIVKDDEILFENALTPLTNRIVSGKEVLQSVYETYGHKTLYAVNVTGRTFDLKENAKRAVQAGADILLFNV 241 Bacillus anthracis
WP_015383506 164 LRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNV 243 Bacillus subtilis
WP_009328611 163 LRQQALGGVDLIKDDEILFETGSAPFEKRITEGKKVLEEAFEETGRKTLYAVNLTGRTMELKAKARKAAELGADVLLLNV 242 Bacillus
WP_011230454 161 LKKQALGGVDLVKDDEILFDSELLPFEKRITEGKAALQEVYEQTGKRTLYAVNLTGKTFALKDKAKRAAELGADVLLFNV 240 Geobacillus kau...
2ZVI_A       175 LRQQALGGVDLIKDDEIFFETGLAPFETRIAEGKQILKETYEQTGHKTLYAVNLTGRTADLKDKARRAAELGADALLFNV 254 Bacillus subtilis
2OEK_A       161 LKKQALGGVDLVXDDEILFDSELLPFEKRITEGKAALQEVYEQTGKRTLYAVNLTGKTFALKDKAKRAAELGADVLLFNV 240 Geobacillus kau...
3FK4_A       242 FAYGLDVLQSLAEDDEIPVPIMAHPAVSGAYSASKLYGVSSPLLLGKLLRYAGADFSLFPSPYGSVALEKEEALAISKYL 321 Bacillus cereus...
WP_000014200 242 FAYGLDVLQSLAEDDEIPVPIMAHPAVSGAYSASKLYGISSPLLLGKLLRYAGADFSLFPSPYGSVALEKEEALAISKYL 321 Bacillus anthracis
WP_015383506 244 FAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEEC 323 Bacillus subtilis
WP_009328611 243 FAYGLDVLQSFAEDDDIPLPIMAHPAVSGALTSSPHYGFSHSLLLGKLNRYAGADFSLFPSPYGSVALPKRDALAIYDEC 322 Bacillus
WP_011230454 241 FAYGLDVLQALREDEEIAVPIMAHPAFSGAVTPSEFYGVAPSLWLGKLLRLAGADFVLFPSPYGSVALEREQALGIARAL 320 Geobacillus kau...
2ZVI_A       255 FAYGLDVMQGLAEDPEIPVPIMAHPAVSGAFTSSPFYGFSHALLLGKLNRYCGADFSLFPSPYGSVALPRADALAIHEEC 334 Bacillus subtilis
2OEK_A       241 FAYGLDVLQALREDEEIAVPIMAHPAFSGAVTPSEFYGVAPSLWLGKLLRLAGADFVLFPSPYGSVALEREQALGIARAL 320 Geobacillus kau...
3FK4_A       322 TEDDASFKKSFSVPSAGIHPGFVPFIVRDFGKDVVINAGGGIHGHPNGAQGGGKAFRTAIDATLQNKPLHEV--DDINLH 399 Bacillus cereus...
WP_000014200 322 TEDDVFFKKSFSVPSAGIHPGFVPFIIRDFGKDVVINAGGGIHGHPNGAQGGGKAFRTAIDATLQNKPLHEV--DDINLH 399 Bacillus anthracis
WP_015383506 324 VREDA-FNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKaeQCKDLK 402 Bacillus subtilis
WP_009328611 323 TKEDV-FKPTFAVPSAGIHPGMVPLLMKDFGIDHIINAGGGIHGHPNGAAGGGRAFRAVIDAVLEAEPVEEKakRSPDLK 401 Bacillus
WP_011230454 321 TDDQEPFARAFPVPSAGIHPGLVPLIIRDFGLDTIVNAGGGIHGHPDGAIGGGRAFRAAIDAVLAGRPLRAAaaENEALQ 400 Geobacillus kau...
2ZVI_A       335 VREDA-FNQTFAVPSAGIHPGMVPLLMRDFGIDHIINAGGGVHGHPNGAQGGGRAFRAIIDAVLEAQPIDEKaeQCKDLK 413 Bacillus subtilis
2OEK_A       321 TDDQEPFARAFPVPSAGIHPGLVPLIIRDFGLDTIVNAGGGIHGHPDGAIGGGRAFRAAIDAVLAGRPLRAAaaENEALQ 400 Geobacillus kau...
3FK4_A       400 SALQIWG 406 Bacillus cereus ATCC 14579
WP_000014200 400 SALQIWG 406 Bacillus anthracis
WP_015383506 403 LALDKWG 409 Bacillus subtilis
WP_009328611 402 LALEKWG 408 Bacillus
WP_011230454 401 KAIDRWG 407 Geobacillus kaustophilus
2ZVI_A       414 LALDKWG 420 Bacillus subtilis
2OEK_A       401 KAIDRWG 407 Geobacillus kaustophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap