1BDB


Conserved Protein Domain Family
BphB_TodD

?
TIGR03325: BphB_TodD 
Click on image for an interactive view with Cn3D
cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Statistics
?
PSSM-Id: 132368
View PSSM: TIGR03325
Aligned: 6 rows
Threshold Bit Score: 458.87
Threshold Setting Gi: 135974
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BDB_A          1 MKLKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNVLGIVGDVRSLEDQKQAASRCVARFGKI 80  Burkholderia x...
jgi:Pnap_4147   1 MKLTGEVVLITGGASGLGRALVDRFVAEGARVAVLDKSAERLQQMESDHGDKVVGIVGDVRSLQDQKQAADRCVAKFGKI 80  Polaromonas na...
P50206          1 MQLNNEVALVTGGGSGLGRAIVDRFVAEGARVAVLDKSAARLQELQAAHGAKVLGIEGDVRVLADHQKAARECVAAFGKI 80  Pseudomonas sp...
BAC05508        1 MNLKDQVVFITGGASGLGRALVERFVTEGAKVGVLDRSEKGIQELESMHPGRVIGVAGDARLLADNKTAVQRCVDSFGKI 80  Thauera sp. DNT-1
P47230          1 MRLQDEVVLVTGGCAGLGRAIVDRFVCEGARVAVLDRSVAGLEELRAAHGDAVVAVEGDVRYLDSHKETVAKCVETFGKL 80  Rhodococcus gl...
P13859          1 MRLEGEVALVTGGGAGLGRAIVDRYVAEGARVAVLDKSAAGLEALRKLHGDAIVGVEGDVRSLDSHREAVARCVEAFGKL 80  Pseudomonas pu...
1BDB_A         81 DTLIPNAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLYTAAKH 160 Burkholderia x...
jgi:Pnap_4147  81 DTLIPNAGIWDYSTALVDLPEDRIDAAFDEVFHINVKGYIHAVKACLPALVASRGSVIFTLSNAGFYSNGGGPLYTAAKH 160 Polaromonas na...
P50206         81 DCLIPNAGIWDYSMPLVDIPDDRIDAAFDEVFHINVKGYLLAVKACLPALVQSRGSVVFTISNAGFYPNGGGPLYTGAKH 160 Pseudomonas sp...
BAC05508       81 NTLIPNVGIWDYNTPLVDIPDERIDESFDEIFQINVKSGLLAVKAALPYLVSSRGGVIFTISNAGFYPNGGGPLYTASKH 160 Thauera sp. DNT-1
P47230         81 DCYIGNAGVWDYSTALVEIPEDRLDEAFDEMYSINVKGYLLGVKAALGALYASRGSVIFTVSNAGFYPAGGGALYTGAKH 160 Rhodococcus gl...
P13859         81 DCLVGNAGVWDYLTQLVDIPDDLISEAFEEMFEVNVKGYILAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLYTAGKH 160 Pseudomonas pu...
1BDB_A        161 AIVGLVRELAFELAPYVRVNGVGSGGIN-SDLRGPSSLGMGSKAISTVPLADMLKSVLPIGRMPEVEEYTGAYVFFATRG 239 Burkholderia x...
jgi:Pnap_4147 161 AVVGLVRELAFELAPYVRVNGVAPGGMS-TDLRGPSSLGMSGQAISTVPLADMLESVLPIGRMPDTEEYTGAYVFFATRG 239 Polaromonas na...
P50206        161 AVVGMVRELAYELAPHVRVNGVAPGGMS-TDLRGPASLGMANQAISSVPLGEMLTSVLPVGRMPVRAEYTGAYVFFATRG 239 Pseudomonas sp...
BAC05508      161 ALIGVVKELAFELAPYVRVNGVAPGGMA-TDLRGPQSLGMGDRSISSIPLGELLESVLPIGRMPDVREYTGAYVFFANHG 239 Thauera sp. DNT-1
P47230        161 AIVGMVKQLAYELGPHIRVNGIAPGGLGgSDLRGLKALDLAEVSLSKVPLGDMLKDILPTGQMASAEESTGAYVFFATRS 240 Rhodococcus gl...
P13859        161 AVIGLIKQLAHEWGPRIRVNGIAPGGILgSDLRGLKSLDLQDKSISTFPLDDMLKSVLPTGRAATAEEYAGAYVFFATRG 240 Pseudomonas pu...
1BDB_A        240 DAAPATGALLNYDGGLGVRGFFS 262 Burkholderia xenovorans LB400
jgi:Pnap_4147 240 DTVPATGALLNYDGGMGVRGFFS 262 Polaromonas naphthalenivorans CJ2
P50206        240 DTFPTTGALLNHDGGMGVRGFFE 262 Pseudomonas sp. KKS102
BAC05508      240 DAAPATGAVLNYDGGMGVRGLFS 262 Thauera sp. DNT-1
P47230        241 ETVPLTGSVLNYDGGIGVRGMSE 263 Rhodococcus globerulus
P13859        241 DTVPLTGSVLNFDGGMGVRGLFE 263 Pseudomonas putida F1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap