Conserved Protein Domain Family
alt_F1F0_F0_C

?
TIGR03322: alt_F1F0_F0_C 
alternate F1F0 ATPase, F0 subunit C
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F0 subunit C of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132365
View PSSM: TIGR03322
Aligned: 6 rows
Threshold Bit Score: 112.643
Threshold Setting Gi: 499627294
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011342782   2 DYLAWVAVASILSAGLCIGIGAIGPALGEGRALAQALAALAQQPDEANTITRTLFVGLAMVESTAIYCFVVSMILIFANP 81  Pelobacter carb...
CAD78172      23 DSTTSIAVASIIMAGLTTAIGSIGPAFAEGRAVAQALNSIAQQPDSSNTITRTLFVGLAMIESTAIYCFVVSMILLFANP 102 Rhodopirellula ...
WP_011419011   2 DSMTLIAMVSIVTAGLCMAVGSIGPALGEGNAVKQALTAIAQQPDERNSITRTLFVGLAMIESIAIYCFVISMILIFANP 81  Syntrophus acid...
WP_011463471   2 DSLTIIAVASIVIAGITTGFGCMGPALAEGRAVATALTALSQQPDASATITRTLFVGLAMIESTAIYCFVVSMILIFANP 81  Albidiferax fer...
WP_011357802   2 DILTIVAAVSIFTAGITIAVGSIGPALGEGRAVASALEALAQQPDASSSITRTLFVGLAMIESVAIYCFVTSMILIFANP 81  Pelodictyon lut...
WP_011308028   5 TYITTIAVASIATAGITIGIGVIGPAIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILIFANP 84  Methanosarcina ...
WP_011342782  82 FWRFFL 87  Pelobacter carbinolicus
CAD78172     103 FWNQLT 108 Rhodopirellula baltica SH 1
WP_011419011  82 FWSHAI 87  Syntrophus aciditrophicus
WP_011463471  82 FWNHVI 87  Albidiferax ferrireducens
WP_011357802  82 FWTMAL 87  Pelodictyon luteolum
WP_011308028  85 FWNRAL 90  Methanosarcina barkeri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap