Conserved Protein Domain Family
alt_F1F0_F0_B

?
TIGR03321: alt_F1F0_F0_B 
alternate F1F0 ATPase, F0 subunit B
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132364
View PSSM: TIGR03321
Aligned: 8 rows
Threshold Bit Score: 313.14
Threshold Setting Gi: 499677069
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011575447   1 MPIDWFTVIAQGINFLLLLWLLKRFLYHPIIDGLDAREKKIAGILADADTCKSQAENLRTEYESKLAHIEQERTQLVGEA 80  Pseudoalteromon...
WP_011308027   1 MLIDWFTVIAQVINFLILVWLLKRFLYKPILNAVDAREKRVADELKNADEKEAEAQKEKEKFKRKNEEFDQQRNDFLNKA 80  Methanosarcina ...
WP_011380976   1 MLIDGFTVVAQIVNFLILVWLLKRFFYRPILDALDERENRIASELAAATGKQREAEAELHRFRQKNEEFDQRREVLLTTV 80  Nitrosospira mu...
WP_011463472   1 MLIDWFTVVAQALNFLILVWLLKRFLYQPILDAIDAREKRIALELADADTKRADAKRERDEFQQKNEVFDQQRAALLGKA 80  Albidiferax fer...
WP_011419010   1 MHIDWFVLLAQLVNFLILIYLLKRFLYTRIIQAMNEREAKIAARFDEAERLKREAEEAARVYEEKNSFLQGQEEKMLNQA 80  Syntrophus acid...
WP_011120169   1 MSIDWFTFTAQVINFLVLVGLLRYFLYAPIVRAMQAREQKVTQCLTDAETAKVEANQQRMSLEKQTQLLQERREELLTKA 80  Rhodopirellula ...
WP_011342783   1 MLIDWFTVSAQAINFLILVALLKRFLYGPVLRAMDRREERLASCFAEAENKRLEAQQLEENYRSLLQELEEARGVKLRQV 80  Pelobacter carb...
WP_011357803   1 MLFDWFTFWAQLLNFLILVWLLKRFLYRPVLEAIDEREKKISGELRDADEGRKQAEQAIREWQEKMSRLDAQAAGMLETA 80  Pelodictyon lut...
WP_011575447  81 KNEAQMASQSLLDNARHNAEQIVKKRVAALRLEMAELKQDVLQQNIHEVYAISRKVLTELADGDLHTKMIDKLVQRLNTL 160 Pseudoalteromon...
WP_011308027  81 KEEVQAERQRLFEDVREEASYLRAKQQEALRNEGQNLSQEIGRRTQQEVFFIARKVLTDLTETSLEERAVDVFVQRLRNL 160 Methanosarcina ...
WP_011380976  81 TDEVRAERQRLMEAAHADADRIRISRNEAQQREYQVLHDAIERRTCAEVLAITRKVLADLAGTTLEIHMTEAFIRRLRTL 160 Nitrosospira mu...
WP_011463472  81 MEEAKTERQRLLDDARHAADALATKRQEALRSAQRSMSEALSHRARDEVFAIARKALGDLATTSLEERMGEVFTRRLREM 160 Albidiferax fer...
WP_011419010  81 REVVNHRQKEWMDSAREEVDAIRRRWIETVLQEKAAFLEHLRQRTGKQVFAIARKILDDLADTAIESKMVDVLIDRIHSL 160 Syntrophus acid...
WP_011120169  81 KADADNERQRLIAEARKEADTRREHWTSTFERDQKDLADQTRRDIQRMGFQAARETVQQLADEDLQKRVCQTFVKQLQTL 160 Rhodopirellula ...
WP_011342783  81 EEEIEDQRHKLLAAARQEAAEIQSAWAASIRDERSSFFTELKKRVGSEMLNIARKSLGDLANIELEQLMVERFNERLAQL 160 Pelobacter carb...
WP_011357803  81 RKEAGEEKKRLQGEARREYDELRGRLRESLHEEQAALGRTIAGRIRAEVFRVSDSVLNSLADSGLQAQMARAFSGRLSEG 160 Pelodictyon lut...
WP_011575447 161 DDDQHAALTRALANSGNQ------------------------IVVRSAQPLAEAQKKQLLACLQQYLpsfkkdssqnnsv 216 Pseudoalteromon...
WP_011308027 161 KDNEKKQLASALSTSPGQ------------------------VLIRTAFDLPQAQRDSIKKTIKETL------------- 203 Methanosarcina ...
WP_011380976 161 GPEEKAQLAVALQAGGVEsghsatfqvfppivgqgspsgiavILVRSAFELPAEQQEKISTVIRETL------------- 227 Nitrosospira mu...
WP_011463472 161 DAKAKAALGEALKTASEP------------------------ALVRSAFELPADQRAAIQNAINETF------------- 203 Albidiferax fer...
WP_011419010 161 DPAEREKICSALEDSEEG------------------------AIVQSAFALFPEDRQRLTDTVRDLL------------- 203 Syntrophus acid...
WP_011120169 161 GEDQLAAIATQLADSGNP------------------------VLVRSAKGLDSSDQNQIRDAIHRVF------------- 203 Rhodopirellula ...
WP_011342783 161 DRNEQQQVALAASERG--------------------------VLVRSPFTLPPELRDRLTQGVRQAL------------- 201 Pelobacter carb...
WP_011357803 161 GTE----VEELLKSGGTP------------------------LVLRSGFEMGEEEKELVRKTLADRF------------- 199 Pelodictyon lut...
WP_011575447 217 naapsnpA-PSIKLSESIVPRLINGIELTMGGWKLAWSTDNYLAELQEDVE 266 Pseudoalteromonas atlantica
WP_011308027 204 -------G-IEIQPRFETAPDLVSGIELTTDGQKVAWSIADYLTSMQKSID 246 Methanosarcina barkeri
WP_011380976 228 -------K-EEVRFNFGVEPNLISGIEMIAGGHKVAWSVAGYLASLEEEVS 270 Nitrosospira multiformis
WP_011463472 204 -------S-ADIPLHFATAPEVVCGIELSTNGQKVGWSITDYLASLEKGVD 246 Albidiferax ferrireducens
WP_011419010 204 -------GkPDAVIRYQESSDLIGGIEFLASGHRIAWSISDYLEHLEQDFD 247 Syntrophus aciditrophicus
WP_011120169 204 -------E-NKVEVRFESEPALIAGIEMDAGGYSLPWNAERTLKTMEANVA 246 Rhodopirellula baltica
WP_011342783 202 -------G-EEIDMQYQDRADMPLGIELTVGGLKLSWGVDSYFEQLERDVA 244 Pelobacter carbinolicus
WP_011357803 200 -------G-YKGRLDFMTEESYRGGIALEQGGRSIEWSVNSRLEAIDEASS 242 Pelodictyon luteolum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap