Conserved Protein Domain Family
YdfZ_fam

?
TIGR03318: YdfZ_fam 
putative selenium-binding protein YdfZ
This small protein has a very limited distribution, being found so far only among some gamma-Proteobacteria. The member from Escherichia coli was shown to bind selenium in the absence of a working SelD-dependent selenium incorporation system. Note that while the E. coli member contains a single Cys residue, a likely selenium binding site, some other members of this protein family contain two Cys residues or none. [Unknown function, General]
Statistics
?
PSSM-Id: 132361
View PSSM: TIGR03318
Aligned: 5 rows
Threshold Bit Score: 114.54
Threshold Setting Gi: 488139694
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_000214712  1 MTTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGKTVVVEGCEEKLAPLDLIRLG 65  Enterobacteriaceae
WP_011704234  1 MKIYDRNRNALTPGQRVMIAATGAVDFLKEAHTDNLTPYQAEHEKCVLLANSREQYAPIELIRLG 65  Aeromonas hydrophila
EEW40909     12 MKTYDRNRNAIATGSMVMIAGNGTTGVIKAIHGEGKTAEQLRRADCVEIDGCEGRFCPLDLIRLG 76  Klebsiella pneumoniae subsp. rh...
WP_012210166 22 MMTYDRNRNAITTGSRVMISGTGHTGIIKAIESEGLDAGQIRRGKTVIVEGCEGKFAPVELIRLG 86  Salmonella enterica
WP_002210902  2 VKVYDRNRNQIVPGQRVMIAQSGVIDVAKAIHADGMSAVQAEREKVVELLHTGERHVPFDLVRLG 66  Yersinia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap