Conserved Protein Domain Family
Se_ygfK

?
TIGR03315: Se_ygfK 
putative selenate reductase, YgfK subunit
Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Statistics
?
PSSM-Id: 132358
View PSSM: TIGR03315
Aligned: 5 rows
Threshold Bit Score: 1804.76
Threshold Setting Gi: 500994473
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011218650    2 GDIMRPVPFGELLNRMFSEYKESKSIFGIPSKQFYRKENAKSLSVWGEHCETPVGPAAGPHTQLAQNIVCSWLAGGRFME 81   Photobacteriu...
WP_000502397    2 GDIMRPIPFEELLTRIFDEYQQQRSIFGIPEQQFYSPVKGKTVSVFGETCATPVGPAAGPHTQLAQNIVTSWLTGGRFIE 81   Escherichia coli
WP_011393447    2 SGAMRPIPFKKLLDWILEENRKFHSIFGLPQEKFYRAQPGVYWQLFGEYLENVIGPAAGPHTQLAQNIVAAYLAGGRFFE 81   Moorella ther...
WP_002387142    2 SDIMHPISIEALLNWIFSEYQQDGTIFGI--RKFYHADPTKTISLFGEKMETPCGPAAGPHTQLAQNIIAAYLTGSRFFE 79   Enterococcus ...
WP_012047947    2 GDKMRPISLKKMITWTMEELKEKESIFGIHKNKFYKNDTGKYIELFGERLASPLGSAAGPNSQLTQNIVASYLTGSRFIE 81   Clostridium b...
WP_011218650   82 LKTVQKLDQLEIA--KPCIDAEDECFNTEWSTEFTLVKAYDEYLKAWIALHLLEEVFDPrteGED-KSFVFNMSVGYDLA 158  Photobacteriu...
WP_000502397   82 LKTVQILDRLELE--KPCIDAEDECFNTEWSTEFTLLKAWDEYLKAWFALHLLEAMFQP---SDSgKSFIFNMSVGYNLE 156  Escherichia coli
WP_011393447   82 LKTVQVLDRLDIP--KPCINAADEGYNVEWSTELAIEEAFEEYVKAWFLLHVLQKELWG---TDR-RGFMFNMSVGYDLK 155  Moorella ther...
WP_002387142   80 VKTVQILDGEDLPvsKPCIAAADECYNVEWSTELRVPQAYDEYVKAWFVLKLLSKEFEL---GDP-NGFIFNMSVGYDLA 155  Enterococcus ...
WP_012047947   82 LKTIQVIDGEDLPvaKPCIHAQDECYNVEWSTELTVPEAYDEYIKAWFLLHVLMKELNL---SEE-RDFMFNMSVGYDLD 157  Clostridium b...
WP_011218650  159 GIETAPMQKYIDDMVDSSQHENFHAYVAELKTFIN-----DPEFIKtygfehrlarlenlpaS----------------I 217  Photobacteriu...
WP_000502397  157 GIKQPPMQQFIDNMMDASDHPKFAQYRDTLNKLLQ-----DDAFLA----------------RhglqekreslqalparI 215  Escherichia coli
WP_011393447  156 GIKSPKVDRFIESLKDASKTAIFQECRAVLQAEVDrftavDAEFID----------------G----------------I 203  Moorella ther...
WP_002387142  156 GIQSPKIDRYINEMQNAEGTPIWAECQAAAKKYLSyfkkvDDLYIE----------------A----------------I 203  Enterococcus ...
WP_012047947  158 GIKSPKVDTYIEGMRNASTTKIWNECRETLLSNIDlfsnfSIEDLD----------------K----------------I 205  Clostridium b...
WP_011218650  218 STQLTRGVTLSTMHGCPPNEIEAICRYMIADKHINTFVKLNPTLLGYTRVRSIMDNAGFDYIALSEESFSHDLQIEPAKA 297  Photobacteriu...
WP_000502397  216 PTSMVHGVTLSTMHGCPPHEIEAICRYMLEEKGLNTFVKLNPTLLGYARVREILDVCGFGYIGLKEESFDHDLKLTQALE 295  Escherichia coli
WP_011393447  204 SPHICSSVTLSTMHGCPPAEIETICRYLLAEKRLHTFVKLNPTLLGYKFVKDTLAGMGYSYVQLKEESFSHDLQYTDGVA 283  Moorella ther...
WP_002387142  204 SPKVCHSITLSTLHGCPSDEIERIAAYLLSEKGLHSFIKCNPTMLGYEYARQTMDELGFDYMVFDDHHFKEDLQFEEAVP 283  Enterococcus ...
WP_012047947  206 SPVVCPSITLSTLHGCPPEEIEKIAKYLLEEKNLHTFIKMNPTLLGEKFVRDTFDKMGYDYIVLNPNHFINDLQYKDGVS 285  Clostridium b...
WP_011218650  298 MLHRLVDLGKEKGIGFGVKLTNTLGTLNKKGRLPDKEMYMSGRALFPLSINVALELSREFNGTLPISYSGGASKFNIKEI 377  Photobacteriu...
WP_000502397  296 MLERLMALAKEKSLGFGVKLTNTLGTINNKGALPGEEMYMSGRALFPLSINVAAVLSRAFDGKLPISYSGGASQLTIRDI 375  Escherichia coli
WP_011393447  284 LIGRLQEFAREQGRGFGVKLSNTLPVQVTRGELPGEEMYLSGRALYPLTLNLAARLAQEFNGHLRISYAGGGDAFNLPRL 363  Moorella ther...
WP_002387142  284 MLQRLQLLANSKNLSFGVKITNTFPVTIAANELPGDEMYMSGRSLFPLSISLAQKLSEAFDGKLQISYSGGADIFNSKEI 363  Enterococcus ...
WP_012047947  286 MLKRLKYVAQKLKLEIGVKLTNTLPVKIENGELPGEEMYMSGRSLFPLTISLANKLASEFDGDLQISYSGGADFFNIEKI 365  Clostridium b...
WP_011218650  378 FETGIRPITMATDLLKPGGYLRLADCAKELETSSEWGMGKV-DLVKLEALAAKSLVAEYTQKEWRGPEEISVKKALPLTD 456  Photobacteriu...
WP_000502397  376 FDTGIRPITMATDLLKPGGYLRLSACMRELEGSDAWGLDHV-DVERLNRLAADALTMEYTQKHWKPEERIEVAEDLPLTD 454  Escherichia coli
WP_011393447  364 FATGIWPLTVATTLLKPGGYLRLQQIAAELATRMPDTAGEViDVAQLAGLAAGVTRDPDFRKEKRGVASRKLTRKLPLTD 443  Moorella ther...
WP_002387142  364 FDAGIWPITMATTLLKPGGYQRMNQVANVLSAAEYPQMVHV-NLDKLAQVVEKAKTQARYQKSIKLPESTKLRKTVPLTD 442  Enterococcus ...
WP_012047947  366 LKAGIQPITFATTILKPGGYERITQMAQKVEEYLKGAFKGI-DIQYLNELANSAVSDKYHLKDLRPVNSRKISLELPIYD 444  Clostridium b...
WP_011218650  457 CYVAPCVT--ACPISQDIPEYIRLMGLSQYTEALEVIYSRNALPAITGHICDHQCQYNCTRRDYEGALNIREMKKVALAK 534  Photobacteriu...
WP_000502397  455 CYVAPCVT--ACAIKQDIPEYIRLLGEHRYADALELIYQRNALPAITGHICDHQCQYNCTRLDYDSALNIRELKKVALEK 532  Escherichia coli
WP_011393447  444 CFLAPCTA--GCPIGQDIPEYIRLVGEKRYREAYELIIEKNPLPFITGSICTQHCAAKCTRLDYDEPVRIREMKKEAAVK 521  Moorella ther...
WP_002387142  443 CYIAPCRSdgGCPINQDIPAYLRYVSEGNYLKALQVIVDKNPLPFITGTICAHPCMTKCTRQFYEESIHIREVKLEAAEH 522  Enterococcus ...
WP_012047947  445 CAVAPCTI--GCPINQQIPEYVSLVGEKKYDEAFEVIAKDNTSPAITGTICNHNCQYKCTRLDYDESVLIRDMKKVAVLN 522  Clostridium b...
WP_011218650  535 GWEGYKAKWHAPDLDSEKHPIAVIGAGPSGLSAAYFMARAGHPVTVFEKEHNAGGVVKNIIPQFRIPAEVIQHDIDFVQD 614  Photobacteriu...
WP_000502397  533 GWDEYKQRWHKPAGSGSRHPVAVIGAGPAGLAAGYFLARAGHPVTLFEREANAGGVVKNIIPQFRIPAELIQHDIDFVAA 612  Escherichia coli
WP_011393447  522 GYRASRPRCGPAQGKASA-RVAVIGAGPAGLAAGYFLARAGLGVTIFDKKGKPGGTVTHVIPDFRLSEDAIARDLELVKG 600  Moorella ther...
WP_002387142  523 AYDELLTTLEKPQPKENAPKTAVVGGGPAGISAGYLLAREGMPVTVFEKSETIGGVCSQIVPEFRISMESVQKDVQLAEF 602  Enterococcus ...
WP_012047947  523 AEDKYIEDIKESNIRSDK-KVAVIGAGPAGLSVALFLRRNGIDVTVMDIKEKPYGVIEYVIPEFRISSEMIKKDFELVKK 601  Clostridium b...
WP_011218650  615 HGVNIEYGCNPHMTVDTLKSSGFKYVCLGIGADKGNPMSLTGDNTNVFKSLEFLRSFNDGeftpspehaPMHTLGKHVAV 694  Photobacteriu...
WP_000502397  613 HGVKFEYGCSPDLTVEQLKNQDFHYVLIATGTDKNSGVKLAGDNQNVLKSLPFLREYNKG---------TALKLGKHVVV 683  Escherichia coli
WP_011393447  601 TGVEFKLGVSPDFNVAELKRAGYKYVFLAPGAGASRPLELRTGGERVMGAVEFLAKFKEDr--------QKVRLGKRVAV 672  Moorella ther...
WP_002387142  603 MGAEFRTG-QEAPSLAELKNQGYTNVIYAIGAWKHGVLRLESG--RALNSLEFLKANRENp--------TINPYGEQIVV 671  Enterococcus ...
WP_012047947  602 QGVKFKFGIDENLDLDALKKE-YDYVVLAIGAWKPGKLTLKEGGEKAIDAISFLENHKKSk--------GDINLGKHVCI 672  Clostridium b...
WP_011218650  695 VGAGNTAMDSARAALQVDGVETVTVLYRRTLAEMPAYKDEYDEAVEDGVKFMFLTNPEEFNaDGTVVARVMKLGEPDEKG 774  Photobacteriu...
WP_000502397  684 VGAGNTAMDCARAALRVPGVEKATVVYRRSLQEMPAWREEYEEALHDGVEFRFLNNPERFDaDGTLTLRVMSLGEPDEKG 763  Escherichia coli
WP_011393447  673 IGGGNTAMDAARAALRVPGVEKVTIIYRRTREYMPASREELREALAEGVVLKELLAPYSWS-EGVLRCQQMELEAPDASG 751  Moorella ther...
WP_002387142  672 VGGGNTAMDCARAATTLPGVKKVSVVYRRNKRNMPADEEELYLALEDGVDFLELLSPIKHE-NQQLTCEKMVLGERDASG 750  Enterococcus ...
WP_012047947  673 IGGGDVAMDAARAAKRTNGVEEVSIVYRRTKKYMPASLEEIELVQTEGILFKELLSPMSIK-DSKLICEEMKLGKKDASG 751  Clostridium b...
WP_011218650  775 RRR-PVATDETVELHVDALITAVGEQSNRDALTRIGIPMGEDGWPVVNSEtGETSVENVFLMGDASTGPSSIVSAISGGR 853  Photobacteriu...
WP_000502397  764 RRR-PVETNETVTLHVDSLITAIGEQQDTEALNAMGVPLDKNGWPDVDHN-GETRLTDVFMIGDVQRGPSSIVAAVGTAR 841  Escherichia coli
WP_011393447  752 RPGvAVKAGELVDIPADAVLAAIGQDVDYGLLEKNGIAIDEGGRIVVDPAtNETSVANVFIGGDALRGPATIVEAIADGR 831  Moorella ther...
WP_002387142  751 RRR-PIGTGEMIDIPADTVIAAVGEKVDTEFYQALGIHTDNYGKVVSNQEtLETNIPGVYVIGDANLGPATIVEAIADAT 829  Enterococcus ...
WP_012047947  752 RRK-PVGTGNTVELEADTVILAVGQQVDSDLLKKNKIELDAKEFPKINEA-RETNITNVYVAGDMKKGPATIVKAMADGK 829  Clostridium b...
WP_011218650  854 KAATTI-------LAREAQNDEL----IavkSDVQVDDIYARKGEIQvklieantleI-----DDHEAFIQQESQRCLEC 917  Photobacteriu...
WP_000502397  842 RATDAI-------LSRENIRSHQndkyW---NNVNPAEIYQRKGDIS----------ItlvnsDDRDAFVAQEAARCLEC 901  Escherichia coli
WP_011393447  832 KAARAI-------LTREGLTPPVpg-aVpfdREWRLREVNQKKGNL-----------------AGAAGDPGLEPQRCLEC 886  Moorella ther...
WP_002387142  830 KAANNIclvhnhhYEKDNLNSDV-------------AFVRNKRGILV----------T-----DEMSCS---QASRCLEC 878  Enterococcus ...
WP_012047947  830 AVSKDI-------LSKEGLSNDFdkkvFpinE----KKVYSKKGIL-----------------RDHNCL-ENESERCLSC 880  Clostridium b...
WP_011218650  918 SYVCSKCVDVCPNRANISLPI--PGFRDQFQTIHLDAYCNECGNCAQFCPWDSKPYKDKFTLFNLRDDFTNSTNAGFYIE 995  Photobacteriu...
WP_000502397  902 NYVCSKCVDVCPNRANVSIAV--PGFQNRFQTLHLDAYCNECGNCAQFCPWNGKPYKDKITVFSLAQDFDNSSNPGFLVE 979  Escherichia coli
WP_011393447  887 GFVCNICTEVCPNRANIAIQTrnGGFRDQNQIVHVDGMCNECGNCATFCPYDGAPYRDKLTLFWKEEDFAGSQNNGFLLL 966  Moorella ther...
WP_002387142  879 STICESCMDVCPNRANIVVYV-----EGKPQIVHVDRMCNECGNCETFCPYASAPYKDKFTLFNSEADFYDSTNSGFYVQ 953  Enterococcus ...
WP_012047947  881 SNICELCVDVCPNRANVVINVd-AEFNSSHQIVHLDGMCNECGNCGIFCPYEGNPYKDKLTLFWTKEDFENSTNKGFLVI 959  Clostridium b...
WP_011218650  996 GTEV----LV-RSEGEIYTFSINEQSEL--DMPESLADEatIISYVHA-HHsYLL 1042 Photobacterium profundum
WP_000502397  980 DCRV----RV-RLNNQSWVLNIDSEGQFn-NVPPELNDMcrIISHVHQhHH-YLL 1027 Escherichia coli
WP_011393447  967 AGGAelvfKV-RLNGRVQEVKFDPAGKAnvDLEQGVLDL--ILAVYKG-YR-YLF 1016 Moorella thermoacetica
WP_002387142  954 NPVDki-cLL-RLWGTVSTIQLTDQGL---DVPEDLIAL--MVTMIEE-YA-YCM 999  Enterococcus faecalis
WP_012047947  960 DKDKgi-cKVrREDTEIIDYTI---GKEn-DVSKEMDSM--IKTFVNE-YS-YML 1005 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap