Conserved Protein Domain Family
Se_ssnA

?
TIGR03314: Se_ssnA 
putative selenium metabolism protein SsnA
Members of this protein family are found exclusively in genomes that contain putative set of labile selenium-dependent enzyme accessory proteins as well as homologs of a labile selenium-dependent purine hydroxylase. A mutant in this gene in Escherichia coli had improved stationary phase viability. The function is unknown.
Statistics
?
PSSM-Id: 132357
View PSSM: TIGR03314
Aligned: 6 rows
Threshold Bit Score: 733.507
Threshold Setting Gi: 499537866
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012047946   2 LLIGNGKVITRDNTRPIIDNGCIAVDENKIIEIGSTETLKNKYKESQFIDAKGKLIMPGFINTHMHYYSTFARGMANDSP 81  Clostridium bot...
WP_002359625   2 LLIGNGRLITRDAQNHFFENGCVAIDGQVVKQVGTTEELKQAYPEATFIDAKGGVIMPGFINMHNHIYSTFARGLSLTNY 81  Enterococcus fa...
AAG58008      24 LILKNVTAVQLHPAK-VQEGVDIAIENDVIVAIGDA--LTQRYPDASYKEMHGRIVMPGIVCSHNHFYSGLSRGIMANIA 100 Escherichia col...
WP_011706028   2 FILKNVTAVQLEPTR-VLEGVDIAIEGSLIKAVGPN--LRALYPEATYREMGGKLVMPGIVCAHNHFYSGLSRGIMANIA 78  Aeromonas hydro...
WP_011393455   2 LLIGNGRLLSLVPGKPYQEDGAVAIDGDLIVAVGPTAELKARYPAAEWLDARGMVIMPGMINTHMHLYSTFARGMALKDP 81  Moorella thermo...
WP_011218649   2 LLLKNATAVQFEPAF-IKEGVDIAIDGSTIKEVGAN--LSMKYPDAIVKEMHGKLVMPGLVCSHNHFYSGLARGVMADIK 78  Photobacterium ...
WP_012047946  82 PAKSLCDILTGLWWRLDKVLTLEDVYYSAAVPMIDQIKNGVTTVFDHHASTHAVKGSLFKIAEAAETMGIRSNLCYETSD 161 Clostridium bot...
WP_002359625  82 HPKNFMDILVDQWWRIDRALTLEDTYQSGKVAYLDSIRNGVTTVFDHHASYGEITGSLTQLSNAADELGIRTCLCYEVSD 161 Enterococcus fa...
AAG58008     101 PSPDFISTLKNLWWRLDRALDEESLYYSGLICSLEAIKSGCTSVIDHHASPAYIGGSLSTLRDAFLKVGLRAMTCFETTD 180 Escherichia col...
WP_011706028  79 PCPDFISTLKNLWWRLDRALDEESLYYSGLICSLEAIKSGCSAVIDHHASPNFIKGSLNVLRKGFVEAGLRGMTCFETTD 158 Aeromonas hydro...
WP_011393455  82 PPTNFLEILQRLWWRLDKALTLEDVYYSALLPLIDCIKSGTTTILDHHASPYAVTGSLEMIARAAMETGVRTCLAYEVSD 161 Moorella thermo...
WP_011218649  79 PSPDFISILKNLWWRMDRALDEEAVYYSGLICSLEAIKSGCTSVIDHHASPNYIGGSLSTIRKGFIKAGLRGMTCFETTD 158 Photobacterium ...
WP_012047946 162 RDGE-KIAQEGINENVEFIK-----HCNAKNDDMIKGMFGLHASMTISDKTLEKCVdAVKGLNTGFHVHCGEGIEDLEDS 235 Clostridium bot...
WP_002359625 162 RDGE-QKMREAVQENAAFIK-----ASSLRNDDMQKAMMGMHAAFTLSDASLELCA-ANTPDGIGYHIHIAEDLADVHDS 234 Enterococcus fa...
AAG58008     181 RNNGiKELQEGVEENIRFARqideaKKAATEPYLVEAHIGAHAPFTVPDAGLEMLReAVNATGRGLHIHAAEDLYDVSYS 260 Escherichia col...
WP_011706028 159 RNGGlAELQAGVEENILFAQaidaaKAKGSEPYLVEAHIGAHAPFTVPDEGLAMLReAVQVTGRGLHIHVAEDRYDMAHG 238 Aeromonas hydro...
WP_011393455 162 RDGK-EIMRQGIAENIAAIK-----KYRGKEG-LISATFGLHASLTLSDATLEACReAEGEVGSGFHIHVAEGIQDVEDA 234 Moorella thermo...
WP_011218649 159 RNGGmKEMMAGVEENIAFAQlidraKEEGTEPYLVEAHIGAHAPFTVTNDGLAMMAeAVQATGRGIHVHVAEDRYDVTHS 238 Photobacterium ...
WP_012047946 236 KKKYGKGIIERWNNAGVLCDKTIAVHCIYVSDEEMDMLKEKNTIVVHNPESNMGNAVGVSPVLKMYKK-GILLGLGTDGY 314 Clostridium bot...
WP_002359625 235 LKKYGKPIVNRLFDLGILGKQTMAGHCIHIGPHEMELLRDTDTMVVTNPESNMGNAVGCPPAMRMFNEyGILMGLGTDGY 314 Enterococcus fa...
AAG58008     261 HHWYGKDLLARLAQFDLIDSKTLVAHGLYLSKDDIALLNQRDAFLVHNARSNMNNHVGYNHHLSDIRN----LALGTDGI 336 Escherichia col...
WP_011706028 239 HHHHGKEPIARLDEFGLVDSKTLIAHGIYLSPADIELLNSRDAFLVHNARSNMNNHVGYNLHLPEYRN----LALGTDGI 314 Aeromonas hydro...
WP_011393455 235 LAKSGKRVVERLAVNGILGPNTIAAHCVHVTDREIAILKETGTLVVHNPESNMGNAVGCAPVGDMLAA-GVPVGLGTDGY 313 Moorella thermo...
WP_011218649 239 HHHYGQDIVERLDSFGLINEKTLLAHGLFLSDRDIDILNAKDGFLVHNARSNMNNNVGYNNKLIRFKN----VALGTDGI 314 Photobacterium ...
WP_012047946 315 TPDIIESYKVANIIHKHATSDSTVAWTEIPEMLFENNGKITERFIDGKIGVLKEGALADIIVVDYNPPTPINENNINSHI 394 Clostridium bot...
WP_002359625 315 TNDVTESYKVGNVIHKHHLADPNAAWAEIPTMLFDNNPQMANRYFKTKLGVLEPNAAADVIIVDYHGPTPMTKENYNMHI 394 Enterococcus fa...
AAG58008     337 GSDMFEEMKFAFFKHRDAGGPL---WPDSFAKALTNGNELMSRNFGAKFGLLEAGYKADLTICDYNSPTPLLADNIAGHI 413 Escherichia col...
WP_011706028 315 GSDMLEELKFAYFKHKDAGGAL---WPDSFARFLWNGNTLLERNFGAKFGRLEPGYKADLTICDYAAPTPLAPRNLGGHL 391 Aeromonas hydro...
WP_011393455 314 TSDMFESLKTANVLRKFVSGDPGAGWAEVPAMAFENNRRIASRFFPHPLGRLEPGAYADVILVDYQAPTPLGRDNWFGHL 393 Moorella thermo...
WP_011218649 315 GADMFEELKFSFFKHRDAGGPL---WPDSFMKNLWNGNEILARNFGAKFGRLDAGNKADLTILDYTSPTPFVADNLAGHV 391 Photobacterium ...
WP_012047946 395 LFGINGRHVDTTIINGKVLMEDRKLLHVDEERVMARSRELAKEVWKRF 442 Clostridium botulinum
WP_002359625 395 LFGMNGGMVTDTVINGEIRMRNREVQGIDEEKVWHDAQTQAQSFWKRV 442 Enterococcus faecalis
AAG58008     414 AFGMGSGSVHSVMVNGVMVYEDRQF-NFDCDSIYAQARKAAASMWRRM 460 Escherichia coli O157:H7 str. EDL933
WP_011706028 392 AFGMGSSSVNSVMVEGRMVYQDREF-AFDVAPLYEQASKVASRLWQRM 438 Aeromonas hydrophila
WP_011393455 394 LFGFNGGLVDTTVVGGKVLMQRQRLLHLDEAAIAARARELAIKVWERF 441 Moorella thermoacetica
WP_011218649 392 AFGMNAGNVNSVMVEGRFVYEDRAF-PFDIAPIYAEASKVAERLWKTM 438 Photobacterium profundum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap