Conserved Protein Domain Family
Se_sel_red_Mo

?
TIGR03313: Se_sel_red_Mo 
probable selenate reductase, molybdenum-binding subunit
Our comparative genomics suggests this protein family to be a subunit of a selenium-dependent molybdenum hydroxylase, although the substrate is not specified. This protein is suggested by Bebien, et al., to be the molybdenum-binding subunit of a molydbopterin-containing selenate reductase. Xi, et al, however, show that mutation of this gene in E. coli conferred sensitivity to adenine, suggesting a defect in purine interconversion. This finding, plus homology of nearby genes in a 23-gene purine catabolism region in E. coli to xanthine dehydrogase subunits suggests xanthine dehydrogenase activity.
Statistics
?
PSSM-Id: 132356
View PSSM: TIGR03313
Aligned: 3 rows
Threshold Bit Score: 2064.57
Threshold Setting Gi: 500025312
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011706030   5 FTLNGALRTVITPAGENAQRVLFNQcRMHSVRNSDDGFGFAGSDAILFNGKVINASLLIAAQLEGAQVRTAESLGSWNQL 84   Aeromonas hydr...
WP_011218640   5 FTLNGRPQTLECKLGENVQTLLHGM-GYHSVRNSDDGFGFAGSDVILLNGVLKNASLLVAAQLEGKEVQTAESLGQWNQL 83   Photobacterium...
WP_000583635   5 FTLNGAPQELTVNPGENVQKLLFNM-GMHSVRNSDDGFGFAGSDAIIFNGNIVNASLLIAAQLEKADIRTAESLGKWNEL 83   Escherichia coli
WP_011706030  85 SLVQQAMVDVGVVQSGYNDPAAALIVTDLLDRHPNPSRDQIDDALSGLFHRDGGYQQFYQAIELASSRLKDPDYLCQIAP 164  Aeromonas hydr...
WP_011218640  84 SLVQQAMIDVGVVQSGYNDPALALILTQLLETNTQPNRAEIDDALSGLFSRDAGYQQFYEVVELAVKRLKDPEHKQSFAP 163  Photobacterium...
WP_000583635  84 SLVQQAMVDVGVVQSGYNDPAAALIITDLLDRIAAPTREEIDDALSGLFSRDAGWQQYYQVIELAVARKNNPQATIDIAP 163  Escherichia coli
WP_011706030 165 EFRGDLRHIGKSCPKVDAAKMVQAKPCYVEDRVSEDALVIKMLRSPHPHAVITKLDVSRAEAMPGVVHVITHLNCPDVYY 244  Aeromonas hydr...
WP_011218640 164 EFRDDLTIVGKNCPKIDSAKMVQAKPCYVEDRIPANACVVKVLRSPHPHAWITHLDVSKAEALPGVVSVITHLNCPDIPY 243  Photobacterium...
WP_000583635 164 TFRDDLEVIGKHYPKTDAAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVITHLNCPDIYY 243  Escherichia coli
WP_011706030 245 TPGGQSAPEPSPLDRRMFGRKLRHVGDRVAAVVAESEAIALAALKLIEVEYQVLPAVMNIDEAMAPNAPLVHDEPIVYMA 324  Aeromonas hydr...
WP_011218640 244 TPGGQSAPEPSPLDRRMFGQKMRHVGDRVAAVVAESLEIAEHALTLIDVEFDVLTPVMSIDEARAAEAPIIHNEPIEYGV 323  Photobacterium...
WP_000583635 244 TPGGQSAPEPSPLDRRMFGKKMRHVGDRVAAVVAESEEIALEALKLIEVEYEVLKPVMSIDEAMAEDAPVVHDEPVVYVA 323  Escherichia coli
WP_011706030 325 GAPADLEQQNACSVRRGdEHMIINFPIGSRPHENLAASVHGQIGDVAKGFAEADEIVERTYESTQAQQCPTEPHICFTYM 404  Aeromonas hydr...
WP_011218640 324 GAPDDLEEQNANADPRE-GKLIVNFPIGCYPRKNIAASVRGHIGDLNKGFEEADVIIERTYESKQVQQLPVETHICYSYM 402  Photobacterium...
WP_000583635 324 GAPDTLEDDNSHAAQRG-EHMIINFPIGSRPRKNIAASIHGHIGDMDKGFADADVIIERTYNSTQAQQCPTETHICFTRM 402  Escherichia coli
WP_011706030 405 DGERLVIHASTQVPWHVRRQVARIVGMKQHQVHVIKERVGGGFGSKQDILLEEVCAWATKVTGRPVTFRYTREEEFISNT 484  Aeromonas hydr...
WP_011218640 403 DGERLVMHDSTQVPWHVRRQVAKILGIKQNKVHIVKERVGGGYGSKQDILLEDVCAWATWTTGRPVYFHHTREEEFICNS 482  Photobacterium...
WP_000583635 403 DGDRLVIHASTQVPWHLRRQVARLVDMKQHKVHVIKERVGGGFGSKQDILLEEVCAWATCVTGRPVLFRYTREEEFIANT 482  Escherichia coli
WP_011706030 485 SRHVAKVKVKVGAKKDGTITAIEMDFRANTGPYGNHSLTVPSNGPALSLPLYPCENVRFTVNTYYSNICPTGAYQGYGAP 564  Aeromonas hydr...
WP_011218640 483 TRHVAKVTVKLGATKDGKLTAIDMEFRANTGPYGNHALTVPSNGPALSLPLYPCDNVDFRVTTYYSNICPTGAYQGYGAP 562  Photobacterium...
WP_000583635 483 SRHVAKVTVKLGAKKDGRLTAVKMDFRANTGPYGNHSLTVPCNGPALSLPLYPCDNVDFQVTTYYSNICPNGAYQGYGAP 562  Escherichia coli
WP_011706030 565 KGNFALTMAIAELAEKLGIDQLEMVEHNRVHEGDILKVLGAIGEGKMPTSVPHAASCALEPILKQGRELIAWDSPKAADG 644  Aeromonas hydr...
WP_011218640 563 KGNFALTMAMAELAEELGIDHLDMIETNRVVEGQELKILAAIGEGKMPTSAPKVHSCALKEILREGRKLIEWDSAKQAKG 642  Photobacterium...
WP_000583635 563 KGNFAITMALAELAEQLQIDQLEIIERNRVHEGQELKILGAIGEGKAPTSVPSAASCALEEILRQGREMIQWSSPKPQNG 642  Escherichia coli
WP_011706030 645 DWRIGRGVAIIMQKSGIPDIDQANCMVKLESDGTFIVHSGGADIGTGLDTVVAKLTAEVLHCPLGDVHVISGDTDHALFD 724  Aeromonas hydr...
WP_011218640 643 DWKVGRGAAIIQQKSGIPDIDQANCSIKMASDGTFIVHSGGADIGTGLDTVVSKLTAEVLRCPMDEITIHSGDTDHAPFD 722  Photobacterium...
WP_000583635 643 DWHIGRGVAIIMQKSGIPDIDQANCMIKLESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHALFD 722  Escherichia coli
WP_011706030 725 KGAYASSGTCFSGNAAKKAAENLKEKILFHGAAMLGEPVADVELAFPGLVRGKLGEVSLAKLAHKAETGTGFGILVGTAS 804  Aeromonas hydr...
WP_011218640 723 KGAYASSGTCFSGNAAKRAAEAMREKILKCGAEMLAEPVEDVDVVAPGLVKGKTGEVSYFDIAHKAESGTGWGQLLATGC 802  Photobacterium...
WP_000583635 723 KGAYASSGTCFSGNAARLAAENLREKILFHGAQMLGEPVADVQLATPGVVRGKKGEVSFGDIAHKGETGTGFGSLVGTGS 802  Escherichia coli
WP_011706030 805 YITSELAFPYGANFAEVAVNVRTGQIRLDKFYALLDCGTPINPELALGQIYGATMRAIGHSLTEEICYDGKGIPLTRDLK 884  Aeromonas hydr...
WP_011218640 803 FTTSEFAFPYGANFAEVSVNTRTGEIKLDKFHALLDCGTPVNPDLALGQIYGASMRAIGHSMTEELVYDDNGIPLTRDLK 882  Photobacterium...
WP_000583635 803 YITPDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCGTPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGHPLTRDLR 882  Escherichia coli
WP_011706030 885 SYGAPKIGDIPRDFRAFLVPSDDKVGPYGAKSISEIGVNGAAPAIATAIHDACGVWLRKWHFTPEQILRELGK 957  Aeromonas hydrophila
WP_011218640 883 SYGAPMIGDIPTEFKAVLVPSDDPVGPYGAKSISEIGVNGAAPAIASAIHDACGVWLRDWHFTPEKVLKGLNK 955  Photobacterium profundum
WP_000583635 883 SYGAPKIGDIPRDFRAVLVPSDDKVGPFGAKSISEIGVNGAAPAIATAIHDACGIWLREWHFTPEKILTALEK 955  Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap