Conserved Protein Domain Family
Se_sel_red_FAD

?
TIGR03312: Se_sel_red_FAD 
probable selenate reductase, FAD-binding subunit
This protein is suggested by Bebien, et al., to be the FAD-binding subunit of a molydbopterin-containing selenate reductase. Our comparative genomics suggests it to be a subunit of a selenium-dependent molybdenum hydroxylase for an unknown substrate.
Statistics
?
PSSM-Id: 132355
View PSSM: TIGR03312
Aligned: 3 rows
Threshold Bit Score: 412.368
Threshold Setting Gi: 500025311
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011218641   2 IEHYLQPESTIQALELMKQHTGVAAWFAGGTKLNATPTKTDKTVAISLDKLALDKIELQGEALHIGAMCHIQSLIDNELT 81  Photobacterium ...
WP_000572462   2 IEQFFRPDSVEQALELKRRYQDEAVWFAGGSKLNATPTRTDKKIAISLQDLELDWVDWDNGALRIGAMSRLQPLRDARFI 81  Enterobacteriaceae
WP_011706029   2 IEQFFRPEQLGQALELKARFGNDAVYMGGGSKLNAAPTRTDKKVAISLDKLGLGQIEQQHGQLHIGATVTLQALKDDPRT 81  Aeromonas hydro...
WP_011218641  82 PVALKQAAAFIYSRHIRNQATIGGEIAAFQSEALLVPSLMALKATVILANASQMDIEDYINSEQRELIVEVIIPNVNLMC 161 Photobacterium ...
WP_000572462  82 PAALREALGFVYSRHVRNQSTIGGEIAARQEESVLLPVLLALDAELVFGNGETLSIEDYLACPCDRLLTEIIIKDPYRTC 161 Enterobacteriaceae
WP_011706029  82 PAALCEALGFVYSRHLRNQATLGGEIACQQQDSPLLPVLLVLEAVVVLENNQLQPIDAYLAGQRKELVLGVVLPEPELRC 161 Aeromonas hydro...
WP_011218641 162 IGYNITRSAAGLAVVTAAVSVDQKGNKIIALDGVSPfhhgyaVPVRLRDIEAQDLKGELLEQAVADAVHPVANLCGSIEY 241 Photobacterium ...
WP_000572462 162 ATRKISRSQAGLTVVTAAVAMTDHDGMRIALDGVAS------KALRLHDVEKQNLEGNALEQAVANAIFPQEDLRGSVAY 235 Enterobacteriaceae
WP_011706029 162 ATRRISRNADGLAVMTAAVALDALGEMRVALAGVTP------QPMRLRDVERHELRDAALEAAVSALIAPRADLGGSVAY 235 Aeromonas hydro...
WP_011218641 242 KRYIAGVVVTDLLAECQHLAQEA 264 Photobacterium profundum
WP_000572462 236 KRYITGVLVADLYADCQQAGEEA 258 Enterobacteriaceae
WP_011706029 236 KRYISGVVVADLLVECQQQEVQA 258 Aeromonas hydrophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap