Conserved Protein Domain Family
Se_dep_XDH

?
TIGR03311: Se_dep_XDH 
selenium-dependent xanthine dehydrogenase
Members of this protein resemble conventional xanthine dehydrogenase enzymes, which depend on molybdenum cofactor - molybdopterin bound to molybdate with two sulfur atoms as ligands. But all members of this family occur in species that contain markers for the biosynthesis of enzymes with a selenium-containing form of molybdenum cofactor. The member of this family from Enterococcus faecalis has been shown to act as a xanthine dehydrogenenase, and its activity if dependent on SelD (selenophosphate synthase), selenium, and molybdenum. [Purines, pyrimidines, nucleosides, and nucleotides, Other]
Statistics
?
PSSM-Id: 132354
View PSSM: TIGR03311
Aligned: 4 rows
Threshold Bit Score: 1555.97
Threshold Setting Gi: 499712761
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002356597   2 YSIIVNG--QSETCETNKKLMDFLREDLGLTGTKDGCNQGSCGACTVLVNGKASKACLFTLEKLAGKEVTTIEGLSQRQK 79  Enterococcus fa...
WP_021136977   2 YEFILNE--RNVSVSEDINLLEYLRDNEDLTSVKNGCAEGACGACMILVNGKALRACICTTAKVNGKDVKTVEGLTEFEK 79  Clostridium bot...
WP_009891588   2 VEFILNG--EKVVAKEGKKLLDFLREDMNITSVKNGCSEGACGTCMVIIDGKATKACVFKTDKLAGKNITTIEGLSERER 79  [Clostridium] d...
WP_011393495   3 LQLLVNGqqREVDVNEEATLLEVLREHLRLTGAKNGCGEGTCGACTVIMGGKAVRACRTPVARAAGQEIITVEGLTPREK 82  Moorella thermo...
WP_002356597  80 DVYAYAFAKTGAVQCGYCIPGMVISAQGLLNKKPEPTKEDIQKAIRGNICRCTGYVKIIEAIQLAAKMFCEEASIPEEHS 159 Enterococcus fa...
WP_021136977  80 DVFTWAFSKAGAVQCGYCIPGMIISAKALLDKNLNPNKKEIKTAIRGNVCRCTGYVKIIKAIEMAAGAFRNGKLPFAKEY 159 Clostridium bot...
WP_009891588  80 DVFAYSFASQGAVQCGFCIPGMVISSKALIDVNNNPTEDDIKKALKGNICRCTGYVKIIKAVDLAAKIFRENIDVPKVNC 159 [Clostridium] d...
WP_011393495  83 EIYAWAFTAAGAVQCGFCTPGMVMEAKALLDRQPDPGEAEIRQALKAHLCRCTGYQKIITAVRLAGQALRGEIEPYRGEP 162 Moorella thermo...
WP_002356597 160 NGKLGEDFQRVDAVEKTLGTGIYVDDIDIEGMLHASALRSAYPRAKVLSIDSTQALAHPDCVAVFTAKDVPGNNKIGHLe 239 Enterococcus fa...
WP_021136977 160 KGKIGENIPRIDAKDKILGIGKYVDDMKIEGMVYGSALRSKYPRALVKSIDISVALKHPEVEAILTAEDVPGNRLIGHI- 238 Clostridium bot...
WP_009891588 160 KGLVGENLPRVDAVGKALGYSEYVDDMRIEGMIYGSAVRAKYPRALVKKIDIEEAKAYPGVVAVLTAKDIPGTIKVGHL- 238 [Clostridium] d...
WP_011393495 163 AG-LGKAFFRPDAPPKVLGEAVFVDDMQVPGMLYGAVFRLPVARARIKGIDTTVARKQPGVVAVLTADDIPGKRYQGHI- 240 Moorella thermo...
WP_002356597 240 fISDWDVMIPEGEITRYVGDAVALVVSKRKETLPEIKNLVEVDYEEMIPLTSCEAALAEGAPAIHEKGNILSHEHLVRGN 319 Enterococcus fa...
WP_021136977 239 -VKDWPAMIAVGEGTRYVGDAVALVAAKSKKALKEILNLIKVEYEELEPISNPNIAIAEDAPKIHPKGNILTVEKVNRGD 317 Clostridium bot...
WP_009891588 239 -KKDWDTLIPEGEITRYLGDGIVLVAAETREALEEAKKLVKIDYEELTPLSTTADALREDAPKIHETGNILVKEHLVRGN 317 [Clostridium] d...
WP_011393495 241 -FKDWPALVAVGEETRYAGDALALVAAKSTREARAALDFIKVDYEELPPLTSPEEALAPGAPALHPRGNLLSETQVKKGD 319 Moorella thermo...
WP_002356597 320 AEEVLENSAFVVTEHYSVPINEHAFMEPECAIAQP-EGEGILLFSAGQSIYDEQREVARMLGLDKEKIHVQSKLVGGGFG 398 Enterococcus fa...
WP_021136977 318 VDEAIANSKYVVTNHYSTPFTEHAFLEPESALAMP-DGDGVIIYTGSQGIYDEQREISELLGLPKEKVRTISKYVGGGFG 396 Clostridium bot...
WP_009891588 318 AKEKIENSKYVVTKRYTTPATEHAFLEPECAVAGPyEDDGVIIYSTDQGVFATQHECADMLGLPYEKVRVINKMVGGGFG 397 [Clostridium] d...
WP_011393495 320 AEAALRSCAHVVTNTYQTPFTEHAFLEPESALAVP-ENGGLTVYTSTQGVYEIHAQLVSLLNLPPDKIRVINRFVGGGFG 398 Moorella thermo...
WP_002356597 399 GKEDMSVQHHASLAAWLLKKPVKVLLSREESLMVHPKRHGMEMDFTTGCDEEGNLTAMKAVIYADTGAYASLGGPVLQRA 478 Enterococcus fa...
WP_021136977 397 GKEDMSVQHHAALLAWTIKKPVKITLSRKESIKIHPKRHAMEMTITTACDEKGNLTAFKADIISDTGAYASLGGPVLQRA 476 Clostridium bot...
WP_009891588 398 GKEDMSVQHHAALLAYHTKRFVKVQLTRKESIIVHPKRHATEMEFTTACDENGYLTGMKATIISDTGAYASLGGPVLQRL 477 [Clostridium] d...
WP_011393495 399 GKEDLSVQHHAALLAWATQRPVKLTWTRRESILCHPKRHAMTITMTTGCDAAGNLVALVADLVADTGAYASLGAQVLERA 478 Moorella thermo...
WP_002356597 479 CTHAAGPYKYQTIDVEGFAVYTNNPPAGAFRGFGVCQTAFAIESNLNLLAEKVGLSPWEIRFKNAVAPGDTLPNGQLVSK 558 Enterococcus fa...
WP_021136977 477 CTHAAGPYKCPNVKIKGTAVYTNNPPGGAFRGFGVTQSVFGSECNLNLLAEKVGISPWEIRFKNAVEPGDALPNGQIADK 556 Clostridium bot...
WP_009891588 478 CTHAAGPYNYQDIDITGTAVYTNNPPGGAFRGFGVTQSCFATECNLNLLAEMVGISPWEIRYKNAIRPGQVLPNGQFADE 557 [Clostridium] d...
WP_011393495 479 CTHATGPYRIPNVTIRGRAVYTNNPPAGAFRGFGVPQSNFAMETQMNLLAAATGLSPWQIRWQNALEPGDTLATGQVVSE 558 Moorella thermo...
WP_002356597 559 NAALKEALLAVKDVYEQAEVAGISSFFKNSGVGVGLPDTGRCIISVEEGKIHVRTSAACIGQGMATVTTQIACETLNLPP 638 Enterococcus fa...
WP_021136977 557 GTAIKETILAVKDVYKKSKCAGIACCMKNSGVGVGIPDIGRCNLIVIDGKVHIRTSAACIGQGLGTILTQIICETIGLLP 636 Clostridium bot...
WP_009891588 558 GTAMAETLEAVKEEYEKHPRAGIACAMKNSGVGVGIPDVGRCRLVIKDGKVHIRTSASCIGQGLGTVMTQVVCETASLLP 637 [Clostridium] d...
WP_011393495 559 DIGIKETLLAVKEAYESSPCAGIACAFKNVGLGVGTPDTGRANLAVEGGRVRIYSSAACMGQGLESVLIQIVAETTGLPA 638 Moorella thermo...
WP_002356597 639 EMIVAEAPDTRRTPNSGTTTASRQSLFTGEATRRAAMQLRYELdMGRALSDLEGEEFYGEYSAKTDPLINDKKSPVSHAG 718 Enterococcus fa...
WP_021136977 637 EQIILDLPDTKFAPDSGTTTASRQTVFTGEATRMASLKLKEKL-LTTSLEECEGEEFYGEYQSITDPINSDKKNPVSHVA 715 Clostridium bot...
WP_009891588 638 ENIVHEVPDTHLTPDSGNTTASRQTVFTGEATKVASNKLKEALdSGKTLLDLEGEEFYGEYESITDKMGCDKENPVSHVA 717 [Clostridium] d...
WP_011393495 639 EVIDCVLSDTALTPDAGCTTASRQSLFTGEATRRAAAALAEAL-RGRTLAELEGRVFRGEFHGVTDPLNSTREHPLTHVG 717 Moorella thermo...
WP_002356597 719 YGYAAEVAILDDKGKVAKFVAAYDMGQVVNPRAAEGQIEGGIAMGMGYALTEKFALEEGYVKAK-YATLGLVNATQVPPI 797 Enterococcus fa...
WP_021136977 716 YGYATQVVILDDDGKVERVVAAHDVGKAINLTNVEGQIEGGIVMGLGYAFTEDYPLNKSIPTAK-FGTLGLFRATDIPEI 794 Clostridium bot...
WP_009891588 718 YGYATQVVILDENGKLEKVVAAHDVGRAINPISLEGQIEGGVVMGLGYALTEDYPVVNSVPTAK-FGTLGLFKSTDIPEI 796 [Clostridium] d...
WP_011393495 718 YSYATQVVLLDDAGKVSKVVAAYDIGRAINPLNLEGQIEGGIVMGLGYALTEDFPLREGIPERQtLGRLGLLRSHQVPAM 797 Moorella thermo...
WP_002356597 798 ETILVHADNlhEGLAYGIKGVGELATIPTAPALAGAYFALDGQLRPSLPLENTPYQK 854 Enterococcus faecalis
WP_021136977 795 ETTIIEKNT--NDLAYGAKGIGEITTIPTAPAAQGAYYKFDGNFRKKLPLEDTAYRR 849 Clostridium botulinum
WP_009891588 797 QALIVEKNK--DLLAYGAKGVGEICTVPTAPAVQNAYYVFDKEFRTELPLQNTPYSK 851 [Clostridium] difficile
WP_011393495 798 EVHLIEKGG--TPYAYGAKGVGELATIPTAAAVAGAYYRFDGKVRLSLPLEGTPYTR 852 Moorella thermoacetica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap