Conserved Protein Domain Family
matur_yqeB

?
TIGR03309: matur_yqeB 
selenium-dependent molybdenum hydroxylase system protein, YqeB family
Members of this protein family are probable accessory proteins for the biosynthesis of enzymes with labile selenium-containing centers, different from selenocysteine-containing proteins.
Statistics
?
PSSM-Id: 132352
View PSSM: TIGR03309
Aligned: 9 rows
Threshold Bit Score: 398.226
Threshold Setting Gi: 494350157
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011109556   1 MIVRGGGDLATGVIQKLWHVGFK-ILVLETECPLAIRRTVSVCDAIFQKEQRVEDLVAVRITSLKDCAKCWQQNKLPVFV 79  Enterococcus fa...
WP_024932876  12 VIVRGGGDLASGTIHKLHRSGFK-ILVLETYYPTSIRRNVCYSEAIYTGKITIENTTAIRVSNFNEILKCWQNNEIPITV 90  Clostridium bot...
WP_001020357 271 VVIRGAGDIASGVALRLYHAGFK-VIMLEVEKPTVIRCTVAFAQAVFDGEMTVEGVTARLATSSAEAMKLTERGFIPVMV 349 Escherichia coli
WP_011218687 271 VLIRGAGDIATGVAVRLHNSGFK-VVMTDIAQPTVIRCTVSFAQCLYGDPVEVEGITAQKARSCEEVFTVLEQGNIPVMV 349 Photobacterium ...
WP_011393498   6 VVIKGAGDLASGVAHRLHQSGFQ-VIMTEIPRPTVIRRAVAFAEAVYSGEITVEGVTARLVSDPEGALRVTWQGEVAVLV 84  Moorella thermo...
WP_011343624 175 VVVKGAGDIATGIIWRLHQAGFK-VVATELSKPTAIRRMVAFAQAIYTGEHTVEGITARR-SNLFEVPNLLVNDFIPVIP 252 Carboxydothermu...
WP_011459388   7 VVIKGAGDIATGVGRRLFRCGFP-LVMTEQLQPTPVRRTVAFAEAVYKGETTVEGVTARLIEDPAHVYSTLREGHIPIIP 85  Desulfitobacter...
WP_004513067   9 IIMKGAGEMATGVACRLHRSGFRrILMLEAPSPLAVRRGVSFCEAIHNGRKSVEGIEAVRIENGSALADAWGKGEIPLLA 88  Geobacter metal...
WP_007190630 268 VVVRGGGDLGSGVVYRLQQAGFP-VIVTEVDQPTVVRRAVAFGAALYEDEVEVEGVTGRAAADIDEALELLADDVVPVLV 346 Haloarcula cali...
WP_011109556  80 DQTASAIQQLKPLIVIDAILAKKNL--GTHRGMAPITIALGPGFSAPQDVDVVIETMRGHRLGRLYFEGTALPNTGIPGE 157 Enterococcus fa...
WP_024932876  91 DPRGKFIEMLKPRILIDAILAKKNL--GTRINMAEITIGLGPGFEAGKDVHAVIETMRGHNLGRVILKGEAIKNTGIPGE 168 Clostridium bot...
WP_001020357 350 DPACSLLDELKPLCVVDAILAKQNL--GTRADMAPVTIALGPGFAAGKDCHAVIETNRGHWLGQVIYCGCAQENTGVPGN 427 Escherichia coli
WP_011218687 350 DQECCSLNNLKPTFVVDAILAKRNL--GTTKDMAPVTVALGPGFNAGVDCDAVIETNRGHYLGRVIYHGETQANTGIPGN 427 Photobacterium ...
WP_011393498  85 DPRAEVIAALKPRVVVDAILAKTNL--GTRIDQAPIVIALGPGFTAGTDAHAVIETQRGHYLGRVIWQGAAAANTGIPGE 162 Moorella thermo...
WP_011343624 253 DEEGIVVKELKPWAVVDARLAKKNL--GTKKEEAEIVIGVGPGFTAPEEVHAVIETKRGHYLGRAIYQGSALPNTGIPGE 330 Carboxydothermu...
WP_011459388  86 DPEAHIIRVLNPKVVVDAILAKKNL--GTAKSNAPIVIGLGPGFTAGKDVHAVIETNRGHNLGRVILNGSAEPNTGVPGV 163 Desulfitobacter...
WP_004513067  89 DPQGDAVRRMEPDILIDATIAKRNL--GIAITDAPLVIALGPGFFAGRDCHLVIETNRGHNLGRLIACGEAEPNTGIPGN 166 Geobacter metal...
WP_007190630 347 DPEATVADDLDAAVLVDAIMAKGAFdtGTRREDADVVVGMGPGFEAGEDVDAVVETDRGHELGRVFYDGTASEYDGEPGE 426 Haloarcula cali...
WP_011109556 158 IGGKSAERVVHAPASGQVTHLKNIGDLVLKGEALFLIDQVPVYSPLTGTLRGLISEKVTCYQGLKCADVDPRPvEKVDCL 237 Enterococcus fa...
WP_024932876 169 IGGYSKERVIYSPAKGTIQNVKEIGDFVSSGEILAYVDNIEIKTKISGLLRGLIRNGSIIEKGLKIADVDPRCyEMQNCY 248 Clostridium bot...
WP_001020357 428 IMGHTTRRVIRAPAAGIMRSNVKLGDLVKEGDVIAWIGEHEIKAPLTGMVRGLLNDGLAVVGGFKIGDIDPRG-ETADFT 506 Escherichia coli
WP_011218687 428 IAGYTHQRVLRAPCNGIMHNHVSLGDIVEEGDVIAHVADSPVVSPLSGMVRGLLNEGLTVTEGFKIGDIDPRG-IEADFT 506 Photobacterium ...
WP_011393498 163 VMGYREERVLRAPVAGIFKSCKAIGDSVKAGETVATVNDVPLRAQIGGVLRGVLHDGLEVTAGQKAGDVDPRG-ERDYCF 241 Moorella thermo...
WP_011343624 331 IGGHTVKRVVYSPGRGKVCWYFDFGQEVKAGEVIGTVGEKQIVAAVSGVIRGLIHPEVWVEEGMKIGDIDPRG-IKEYAF 409 Carboxydothermu...
WP_011459388 164 VNGYGSERVLRSPADGAIVPIREIGDFLLKGDVIAVVEGEPVVAPFDGTLRGLVHEKVTVFKGMKIGDVDPRA-SREHCY 242 Desulfitobacter...
WP_004513067 167 IGGYTRERVLRAPADGHFTTEKVIGDQVSKGDVVGIVGTNTVTASIDGILRGLIRPGTHVTTGLKIGDIDPRG-DTAYCH 245 Geobacter metal...
WP_007190630 427 RRGYTHERVLRAPTDGEWTPTVAIGDSVTAGDVVGTVGDRPVETEIDGLVRGLVHGGLSVSEGTKLGDVDPRG-ESVDPT 505 Haloarcula cali...
WP_011109556 238 TISDKARALGGAVLEAIFMI 257 Enterococcus faecalis
WP_024932876 249 TISDKARNIAGGVLEAILYF 268 Clostridium botulinum
WP_001020357 507 SVSDKARAIGGGVLEALMML 526 Escherichia coli
WP_011218687 507 TVSDKARAIGGSVLEAMLHL 526 Photobacterium profundum
WP_011393498 242 TISDKARAIGGGVLEAILHL 261 Moorella thermoacetica
WP_011343624 410 TISEKALAIAGGVLEVLLKL 429 Carboxydothermus hydrogenoformans
WP_011459388 243 TISDKALAISGGVLEAILSH 262 Desulfitobacterium hafniense
WP_004513067 246 TISEKARALGGSVLEAILTV 265 Geobacter metallireducens
WP_007190630 506 KISDKALCLGGGVLEAVLRL 525 Haloarcula californiae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap