3G1P


Conserved Protein Domain Family
PhnP

?
TIGR03307: PhnP 
Click on image for an interactive view with Cn3D
phosphonate metabolism protein PhnP
This family of proteins found in operons encoding phosphonate C-P lyase systems as is observed in E. coli and is a member of the metallo-beta-lactamase superfamily (pfam00753). As defined by this model, all instances of this protein are associated with the C-P lyase, but not all genomes containing the C-P lyase system contain phnP.
Statistics
?
PSSM-Id: 163212
View PSSM: TIGR03307
Aligned: 7 rows
Threshold Bit Score: 419.511
Threshold Setting Gi: 499416625
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3G1P_A        13 AQGVPAWGCECAACARARRSPQYRRQPCSGVVKFNDAITLIDAGLHDLADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGV 92  Escherichia col...
WP_000059897  13 AQGVPAWGCECAACARARRSPQYRRQPCSGVVKFNDAITLIDAGLHDLADRWSPGSFQQFLLTHYHMDHVQGLFPLRWGV 92  Escherichia coli
WP_011092118  22 AQQVPAFGCECEVCQQAQRNESKRRRACCAAITTKDRIILIDAGLPELSPYLLPYPQRHILLTHYHMDHVQGLFPLRWGY 101 Pectobacterium ...
WP_011312800  11 AGGVPLYGCDCPACTRARAVVDFRRQPCTALIEAGETRILLDAGLTDLAERFPSGSLSAIVLTHFHPDHVQGLFPLRWGI 90  Thiobacillus de...
WP_002209284  11 AQQVPVFGCDCVICTQASVDPARRRKPCSAMLYYQGETTLIDAGLPTLDQQFRAGEIQRFLLTHYHMDHVQGLFPLRWGC 90  Yersinia
WP_011104089  11 ARQVPVYGCQCVACSAAQANQDLRRLPCSALIECAGQRWLIDSGLTDLTERFPPRSLNGILQTHYHADHAQGLLHLRWGQ 90  Pseudomonas syr...
WP_011371504  15 VKAAPVYGCDCIACQRALSNQTYRRQAACGVLEVNGVRFLIDAGYLGLEEKFPPGSLDAVLLTHFHMDHVQGLFPIRWGM 94  Thiomicrospira ...
3G1P_A        93 GDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLE-TAHSRVAWLSDTAGLPEK 171 Escherichia col...
WP_000059897  93 GDPIPVYGPPDEQGCDDLFKHPGLLDFSHTVEPFVVFDLQGLQVTPLPLNHSKLTFGYLLE-TAHSRVAWLSDTAGLPEK 171 Escherichia coli
WP_011092118 102 GEPIPVFGPPDEAGCDDLFKHPGILHFQKPLMAFQPFELDGIRITPVPLIHSKLTYGYLIQ-TPTHTLAYLTDTIGLPPE 180 Pectobacterium ...
WP_011312800  91 GKNIPVYGPPDSEGCADLYKNHGLLEFRR-LSKFEPVTIGNLVLTPLPLIHSKATFGYAIEdTDGQRFAYLTDTAGLPPR 169 Thiobacillus de...
WP_002209284  91 GNKIPVYGPPDLDGCDDLFKHPGILDFRPPLTAFQPLQFGELRVTPVPLVHSKITFGYLLQ-SPNRAIAYLTDTVGLSAD 169 Yersinia
WP_011104089  91 GLVIPVHGPADPEGLADLYKHPGILDFSQPFAAFETRALGELHVTALPLAHSRPTFGYLLE-GDGQRVAYLTDTVGLPDA 169 Pseudomonas syr...
WP_011371504  95 GESIPVFSPDDPHGCDDLFKYPGIFDFSKKSLPFEPFHFKGIKITPVPLVHSKLTMGYIVE-FNGKRLAYLCDSGILRRD 173 Thiomicrospira ...
3G1P_A       172 TLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWLMENA--LPSGFEVGFDGMEI 249 Escherichia col...
WP_000059897 172 TLKFLRNNQPQVMVMDCSHPPRADAPRNHCDLNTVLALNQVIRSPRVILTHISHQFDAWLMENA--LPSGFEVGFDGMEI 249 Escherichia coli
WP_011092118 181 TTQFLASHTLDYAIVDCSHPPQTMLPRNHNDITRALEIFTQLNPKQLYLTHISHELDRWLQTQTl-LPENVHAAYDGLVL 259 Pectobacterium ...
WP_011312800 170 TEAFLKNWRPASFALDCSYPPQSDLPRNHNDLTLALTIAETLAPAKVWLTHVSHELDAWLLENIgdLPPHMAVAYDSQVV 249 Thiobacillus de...
WP_002209284 170 SALFLASKSIDLLVLDCSHAPQSPPPRNHNDVTMALAIRDLLMPEETLLTHASHQLDRWLLNNS--LPTGVSVAYDNQTV 247 Yersinia
WP_011104089 170 TCEFLQRQPLDVLILDCSMPPQPQPPRNHNDLTLALESIDQLRPAKAVLTHIGHTLDAWLMEPPqrLPGHVLIGRDGMTL 249 Pseudomonas syr...
WP_011371504 174 VEALLKEHPLDLLILDCDQPPQEKAPRNHNDLTRALDVYESIQPKQLIFTHISHHLDEYFITHPdcLPDGVAIGLDSQTW 253 Thiomicrospira ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap