Conserved Protein Domain Family
altF1_A

?
TIGR03306: altF1_A 
alternate F1F0 ATPase, F0 subunit A
A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F0 subunit A of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132349
View PSSM: TIGR03306
Aligned: 6 rows
Threshold Bit Score: 337.482
Threshold Setting Gi: 499235167
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_007328512   6 ISPDESILWQseaWPVVKINVTLAFTWLVMALLVIGSWWITRRLTSDTKIPRWQNLLEVLVTGIRDQIRDVSRHDPGPYM 85  Rhodopirellula ...
WP_011380978   3 ISPDQLIFWE---YGFVKLNGTIIYTWLLMLLLAVGSKTITKRLSRGEERSRWQNLLEVIIITIQKQISEVGLRQPRTYL 79  Nitrosospira mu...
WP_011575446   3 ISPDEIIYWQ---YGFVKISATLLFTWVVMVVLVSASYLITRNLKKGLHRSRWQNGLEMLVLTIQQQITDAGLTKPRVYM 79  Pseudoalteromon...
WP_011308029   3 LSPDELIFWQ---YDFIKLNATIVYTWGLMLVMVIGSKTITSKLSTGLERSRWQNILEIIVTGILEQIEDVGLDQPRKYL 79  Methanosarcina ...
WP_010932707   3 LSSDEVILWQ---SGFLKLNLTIVTTWALMLLLAGGSALITRRLSTGITISRWQSMLEIIVTMAHRQISEVGLQKPEKYL 79  Chlorobaculum t...
WP_011342781   3 ITPDIFIYWQ---WHDFKINATIAITWLNMLLLVLGAWSVTRKLSDGGSLSRWQNLLEVLVSGMEEQIHDMGLAPPREFL 79  Pelobacter carb...
WP_007328512  86 PFVGTLFLFIAVANLLSIVPGYVAPTGSLSTTAALATCVFVAVPVFGIASHGVGDYLKRYLQPTPLMLPFNLIGELSRTL 165 Rhodopirellula ...
WP_011380978  80 PFLGTLFVFVAVANLFAVFPGYEPPTGSLSTTVALAICVFVAVPFYGIREQGLRRYLQSYLKPVPLLLPFNILGEFTRTL 159 Nitrosospira mu...
WP_011575446  80 GFLGTLFLFIAMSNLLTMVPGFEPPTGSLSTTIALAACVFVSVPYYGIKNRGIKRYLLSYTQPTPFMLPFNIIGELSRTL 159 Pseudoalteromon...
WP_011308029  80 GFLGTLFLLIAVANLCIIIPGYEPPTGSLSTTAALALCVFVAVPLFGIEEQGVSNYLKTYTEPTIIMLPFNIISEISRTL 159 Methanosarcina ...
WP_010932707  80 PFIAALFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFIAVPLFGIAESSLVGYLKTYAEPTPIMLPFNIVGELTRTM 159 Chlorobaculum t...
WP_011342781  80 PFLGSLFLFVLFSNILSVIPGYVAPTGSLSTTTALAVCVFLSVPLWGIQRRGLSGYLRMYIKPSVFMLPFNVMGEVSRTL 159 Pelobacter carb...
WP_007328512 166 ALAVRLYGNMMSGAVIAAILISFVPLFVPIVMQVMGLLTGMIQAYIFAVLAMVYIASATK 225 Rhodopirellula baltica
WP_011380978 160 ALAVRLFGNMMSGTMILAIMLIITPFIFPVVMGVLHLLIGGVQAYIFSILATVYIAAATS 219 Nitrosospira multiformis
WP_011575446 160 ALAVRLFGNMMSGAMILAILLVISPFIFPVIMSVLGLLTGMVQAYIFFVLASVYIGAASV 219 Pseudoalteromonas atlantica
WP_011308029 160 ALAIRLFGNIMSGSMIVAILLTITPFIFPDLMIVLGLLVGMVQAYIFSVLATVYIAAATR 219 Methanosarcina barkeri
WP_010932707 160 ALAVRLFGNMMSGDMILVILLTISPLVFPVLMNILGLLTGMVQAYIFSILATVYIAAATR 219 Chlorobaculum tepidum
WP_011342781 160 ALAVRLFGNVMSGSMIAGILLSIAPLFFPVLMQLLGLITGVIQAYIFavlaavyiaaaaq 219 Pelobacter carbinolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap