Conserved Protein Domain Family
alt_F1F0_F1_bet

?
TIGR03305: alt_F1F0_F1_bet 
alternate F1F0 ATPase, F1 subunit beta
A small number of taxonomically diverse prokaryotic species have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 beta subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132348
View PSSM: TIGR03305
Aligned: 5 rows
Threshold Bit Score: 901.114
Threshold Setting Gi: 499432701
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011308033  11 GKVISVRGSIVDVLFERHLPPVYTLLRAGrlragrESQIAIEVLTQLDAHHVRGIALTPTEGLARGMAVEDTGGPLKAPV 90  Methanosarcina ...
WP_011575443  21 GLVAAVRGSIVDLIFEQHVPPIHNVLYAQ------NKHVVLEVVAQLSAQKIRTIALTATQGLARGMPVEDSGGPLKVPV 94  Pseudoalteromon...
WP_010932711  10 GIVTSIRGSVVDMRFDELLPSIYSVVKTGr-----EMEVTVEILMQLDRRHVRGIALTPTEGLCRGMKARNTGSPLKAPV 84  Chlorobaculum t...
WP_011342777   9 GTVVAVRGGIVDARFDGEMPALHSLLLAGa-----QDEIVVEVMLHLDGGHVRGNALTPTQGLACGDTIKDSGAPLQAPV 83  Pelobacter carb...
WP_011120165  58 GHVVAVRGSVIDVHFPGEPPAMNCELRIGd-----SGDVVAEVASQLDPHTVRAIAITSPRGLSRGTPVRSCGRSMQVPV 132 Rhodopirellula ...
WP_011308033  91 GREILSRMFDVFGNTIDRRKPPSDIQWRSIHQAPPPLMRRSTTSEIFETGIKAIDVLVPLERGGKAGLFGGAGVGKTVLL 170 Methanosarcina ...
WP_011575443  95 GPSTLSRMFNVFGAPIDGHTYQHDGKWRSVHQAPPALTKISSQLQIFETGIKIVDVLCPLERGGKAGLFGGAGVGKTVLL 174 Pseudoalteromon...
WP_010932711  85 GKGTLSRMFDVFGNAIDRRGPVTNVTWRSVHGAPPQLSRRSTKSEVFETGIKIIDLLVPLERGGKAGLFGGAGVGKTVLL 164 Chlorobaculum t...
WP_011342777  84 GQAILGRVFNVFGQPIDRREPPDGCRWRSVLTKPAGLTERSSKTEMFITGIKAIDVLAPLERGGKAGLFGGAGVGKTVLI 163 Pelobacter carb...
WP_011120165 133 GKPLLGRVLDVFGNTLDDGESLKSVEHRSIHQTPPTINRRIAKSEVFTTGIKAIDLLSPLERGGKAGLFGGAGVGKTVLI 212 Rhodopirellula ...
WP_011308033 171 TEMIHNVVKQHQGVSIFCGIGERCREGEELYRDMKDAGVLPHTVMVFGQMNEPPGARFRVGHTALTMAEYFRDDERRDVL 250 Methanosarcina ...
WP_011575443 175 SEMIHNMVSQQQGVSIFCGIGERCREGEELYREMKEAGVLDNMVMLFGQMNEPPGSRFRIGHAALTMAEYFRDDEKKDVL 254 Pseudoalteromon...
WP_010932711 165 TEMIHNMVSKESGVSIFCGIGERCREGEELYRDMSEAGVLDNMVMVFGQMNEPPGSRFRVGLTALTMAEYFRDDLHQEVL 244 Chlorobaculum t...
WP_011342777 164 TELIHNMVGQHEGVSLFCGIGERCREGEELFREMREAGVLDNTVMVFGQMNEPPGARFRVGLTALTMAEYFRDDQGRDVL 243 Pelobacter carb...
WP_011120165 213 TELIHNIVGGHDGISLFCGIGERCREAEELYREMGAAGVRDNTVMVFGQMNEPPGARFRVGHAALTMAESFRDDAKQDVL 292 Rhodopirellula ...
WP_011308033 251 LLIDNIFRFIQAGSEVSGLMGQMPSRLGYQPTLGTELSELEERISTTDAGAIMSIQAVYVPADDFTDPSAVHTFSHLSAS 330 Methanosarcina ...
WP_011575443 255 LLIDNIFRFIQAGSEVSGLMGQMPSRMGYQPTLGTELAGLEERIANTEDGAVTSIQAVYVPADDFTDPAAVHTFSHLSAT 334 Pseudoalteromon...
WP_010932711 245 LLIDNIFRFIQAGSEISGMIGQMPSRLGYQPTIGTELSALEERIANTGTGAITSIQAVYVPADDFTDPAAVHTFSHLSAS 324 Chlorobaculum t...
WP_011342777 244 LLIDNIFRFIQAGMEISGLLGLMPSRLGYQPTMGTELAELQERISSTRHAAITSIQAVYVPADDFTDPAAVHTFSHLSAS 323 Pelobacter carb...
WP_011120165 293 LLIDNIFRFVQAGMEVSGLLGQLPSRVGYQPSLASDLAELEERICTTSDAAITSVQAVYVPADDFTDPSAVHTFAHLSAT 372 Rhodopirellula ...
WP_011308033 331 IVLSRKRASEGLYPAIDPLQSNSKMATPGIIGERHYHLAQKIRQTLAQYSELKDIISMLGLEQLSPEDRNVVARARRLER 410 Methanosarcina ...
WP_011575443 335 LVLSRKRASEGFYPAVDPLQSSSKLATPTVVGQRHYDVARQVKQILAQYNELKDIIAMLGLEQLSKKDRDVVSRARRLER 414 Pseudoalteromon...
WP_010932711 325 LVLSRKRAGEGFYPAVDPLSSGSKMAGESIVGRRHYDLAREVRRVLAQYAELKDIIAMLGLEQLSAEDRRLVGRARRLER 404 Chlorobaculum t...
WP_011342777 324 IVLSRRRASEGLYPAIDPLASTSNILNPRIVGERHYRLAQEIRRTLATYEELKDIIAMLGLEELSREDRRIVFRARRLER 403 Pelobacter carb...
WP_011120165 373 VVLSRKRASEGLYPAIDPLKSTSEMMLPGVVGDRHYKTASNVRQTLAGYEELKDIIAMLGMEELSRQDRLTVNRARRLER 452 Rhodopirellula ...
WP_011308033 411 FLTQPFFTTEQFTGIKGKTVSLSDALDGCDRILHDEFKDYSEGDLYMIGTIDEA 464 Methanosarcina barkeri
WP_011575443 415 FFTQPFFTTEQFTSMKGKFVSLEQALTGCERILQGEFDDYPESALYMIGEIDEA 468 Pseudoalteromonas atlantica
WP_010932711 405 FFTQPFFTTEQFSGLAGKSVPIANTIDGCERILRDEFENYPERALYMIGSIAEA 458 Chlorobaculum tepidum
WP_011342777 404 FLTQPFHTTQQFTGMQGRTVALDAALNGCEAILNDEFSEAPEKILYMIGGLEEA 457 Pelobacter carbinolicus
WP_011120165 453 FLTQPFFTTQQFTGHEGHMVSIEDTLDGCERILNDEFQDRPERDLYMVGKIPSS 506 Rhodopirellula baltica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap