Conserved Protein Domain Family
FrhG

?
TIGR03294: FrhG 
coenzyme F420 hydrogenase, subunit gamma
This model represents that clade of F420-dependent hydrogenases (FRH) beta subunits found exclusively and universally in methanogenic archaea. This protein contains two 4Fe-4S cluster binding domains (pfam00037) and scores above the trusted cutoff to model pfam01058 for the "NADH ubiquinone oxidoreductase, 20 Kd subunit" family.
Statistics
?
PSSM-Id: 132337
View PSSM: TIGR03294
Aligned: 4 rows
Threshold Bit Score: 343.376
Threshold Setting Gi: 499328806
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011449292   4 KITVGHVHMSGCTGCLVSLADNYEGLFTILDNYADLVYCLTLADARHIPKMDVALVEGSVCLQDELSVEEIKETREKAAV 83  Methanospirillu...
WP_010876913  46 KPRIGYIHLSGCTGDAMSLTENYDILAELLTNMVDIVYGQTLVDLWEMPEMDLALVEGSVCLQDEHSLHELKELREKAKL 125 Methanothermoba...
WP_010869522   4 VVKVAHVQLCSCCGCLVSLADTYEKLLDVLNSI-ELVYCQTLADAREIPECDIALVEGSVCLDDHHSLEVAQEVRKKAKI 82  Methanocaldococ...
WP_011019298  20 SCDVAYVQLAGCCGCLVSLTDTYERLLDILDSI-ELVYCQTLMDEREIPECDVAVVEGAVCLNDEHMLEEVEELEEHADT 98  Methanopyrus ka...
WP_011449292  84 VVALGGCAAYGNITRFCRGGQWNQPQHEGFVPIGDVIDVDVYIPGCAPCPQQIRNVCVMaylLLKGTPEqqalakaYLAP 163 Methanospirillu...
WP_010876913 126 VCAFGSCAATGCFTRYSRGGQQAQPSHESFVPIADLIDVDLAIPGCPPSPEIIAKAVVA---LLNNDME-------YLQP 195 Methanothermoba...
WP_010869522  83 VVALGACAATGGVTRYCKGNQLSKPVHSSFSPLTEVIKVDLAIPGCPPSPEAIVGVITA---ALNGDME-------YLQP 152 Methanocaldococ...
WP_011019298  99 IVALGACASTGNFMRLSRGNQQAAPTHEAFVPLTEVADVDYAVPGCPPAPEAIKRFLTL---LLEGKEE-------LLEP 168 Methanopyrus ka...
WP_011449292 164 LMALASEgskatsSEACGCDIMTKVINQGLCMGCGTCATSCPVFAITMEEGKPNIQRDMCIKCGACYAACPRAFFsfdvv 243 Methanospirillu...
WP_010876913 196 MLDLAGY------TEACGCDLQTKVVNQGLCTGCGTCAMACQTRALDMTNGRPELNSDRCIKCGICYVQCPRSWW----- 264 Methanothermoba...
WP_010869522 153 YAELAEKg-----SEACGCDVIYKVVNKSLCMGCGTCAAACPTRAIEMLDGRPNVLKELCIKCGACSVQCPRIRF----- 222 Methanocaldococ...
WP_011019298 169 FAKLAEGk-----TEYCGCDLMYHVVNKSMCMGCGTCAAACPTRAIEIVDGRPVVNENRCIKCGACFTQCPRTIW----- 238 Methanopyrus ka...
WP_011449292 244 NQYENILG 251 Methanospirillum hungatei
WP_010876913 265 PEEQIKKE 272 Methanothermobacter thermautotrophicus
WP_010869522 223 PELIEKIE 230 Methanocaldococcus jannaschii
WP_011019298 239 PGDEAIKE 246 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap