Conserved Protein Domain Family
CoB_CoM_SS_C

?
TIGR03290: CoB_CoM_SS_C 
CoB--CoM heterodisulfide reductase, subunit C
The last step in methanogenesis leaves two coenzymes of methanogenesis, CoM and CoB, linked by a disulfide bond. Members of this protein family are the C subunit of the enzyme that reduces the heterodisulfide to CoB-SH and CoM-SH. Similar enzyme complex subunits are found in various other species, but likely act on a different substrate.
Statistics
?
PSSM-Id: 132333
View PSSM: TIGR03290
Aligned: 7 rows
Threshold Bit Score: 237.733
Threshold Setting Gi: 499343390
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011018943  38 VQACYQCGTCTGSCPSGRRTSYRTRLIMRKLQLGLVDEVIKSDELWMCTTCYTCYERCPRGVKIVDAVKAARNLAAKKGY 117 Methanopyrus ka...
O27906        32 LEYCFQCGTCTGSCPSGRRTPYRVRQIIRKANVGLKDEIISDPALWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGF 111 Methanothermoba...
WP_011406601  32 LAICYQCGTCSGACPSGRRTPYMIRRLVRKALAGLKDQVISDDAIWMCTTCYECQERCPRDIKIVEIVKAIRNVAAHEGY 111 Methanosphaera ...
WP_010870249  32 FKACYQCGTCTGSCPSGRITAFRTRKLIRYAQFGMKSAIIDSEDLWMCTTCYECYERCPRTVKITDIIKVLRNIAAREGK 111 Methanocaldococ...
WP_010870379  33 IKACYQCGTCTGSCPSGRRTAYRTRKVLRKVLLGL-DDVLDSDDIWYCTTCYTCYERCPRDVKITEIIKTLRNIAAQKGN 111 Methanocaldococ...
WP_011448820  41 ANMCYQCGTCTGSCPSAPRSSYRIRLFMRRCVLGLENEALTDPDLWLCTTCYSCTDRCPRDIAPTDVIMAMRNLAFKRDI 120 Methanospirillu...
WP_011032929  16 VLSCMHCGTCTGSCPSGRHTGLNTRRIIRDARKN-RATVLSDDALWLCTTCYTCQERCPRGIPITDALLELRRLAVRKGF 94  Methanosarcina ...
WP_011018943 118 MAKAHRMVAMFVIKTGHAVPINDEIREVRKNIGLDEVPPTTHRYEEALEEVQKLVKINEFDKLI 181 Methanopyrus kandleri
O27906       112 MAPAHKAVGSFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLI 175 Methanothermobacter thermautotr...
WP_011406601 112 MALSHKKTGSFVAKTGHAVPINDKVKTLRKEIGLDEVPATTHKFPEALEEVQTLIKATGFDELI 175 Methanosphaera stadtmanae
WP_010870249 112 MAEAHKKTALYVFKTGHAVPINDQIKKARKEIGLTEIPPTTHKYPDALEVVRGIMKDLRFCDMV 175 Methanocaldococcus jannaschii
WP_010870379 112 MALAHRKTASYVLRFGHAVPANNQIVELRGKLGLPAKSPTAQFSEKDLEEVRTLIKELKFDKLI 175 Methanocaldococcus jannaschii
WP_011448820 121 VPKNFLQTVQLIYNSGHGVPNNDVNRAARTKLGLPADPPTTHSYPEFVKGIQKIIDHYELKENA 184 Methanospirillum hungatei
WP_011032929  95 MRPEHRRVSELVLECGHAVPLDEETKKKREELGLDPIPETVQKYPEALEELKALLKTCKFDELA 158 Methanosarcina mazei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap