Conserved Protein Domain Family
CoB_CoM_SS_B

?
TIGR03288: CoB_CoM_SS_B 
CoB--CoM heterodisulfide reductase, subunit B
Members of this protein family are subunit B of the CoB--CoM heterodisulfide reductase, or simply heterodisulfide reductase, found in methanogenic archaea. Some archaea species have two copies, HdrB1 and HdrB2.
Statistics
?
PSSM-Id: 132331
View PSSM: TIGR03288
Aligned: 7 rows
Threshold Bit Score: 530.845
Threshold Setting Gi: 499328450
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011018942   4 KLCFFLGCIMPNRYPGIEKATRLVFEELGYELVDMDGASCCPAPGVFGSFDLKTWVTIAARNLSIAEEKGYDILTVCNGC 83  Methanopyrus ka...
WP_010877481   2 EIAYFLGCIMNNRYPGIEKATRVLFDKLGIELKDMEGAFCCPAPGVFGSFDKTTWAAIAARNITIAEEMGSDVMTECNGC 81  Methanothermoba...
WP_010870248   2 EFVFFLGCIAPNRYPGIEKATYITMEKLGIKLHPFEKASCCPAPGVFGSFDLKTWLTLAARNLCMAEEVEMDILTICNGC 81  Methanocaldococ...
WP_010870378   2 KYAFFLGCIMPHRYPGVEKATKIVMEELGVELEYMPGASCCPAPGVFGSFDQKTWLTLAARNLCIAEEMGLDIVTVCNGC 81  Methanocaldococ...
WP_011406600   2 AYAYFLGCIMNNRYPGIEKSTRVLMDKLGVELTDMDGASCCPAPGVFGSFDKETWATIAARNITIAEDMGADILTECNGC 81  Methanosphaera ...
WP_011448821   3 EYAFFLGCIAPNRYPGCEASAIKTSEKVGIKLLPLKGASCCPAPGAFGSIDLNVWYAMAARNLVLAEEMKKDIALICNGC 82  Methanospirillu...
WP_011032930  15 KLSLFLGCIVPNRYPGIEKATKLCLQRLEIDACDLPGASCCPAPGVFKSFDKATWLALASRNIVLSERMERDVLTVCNGC 94  Methanosarcina ...
WP_011018942  84 FGSLNEANHLLQENPELREFVNEKLAEIDREYKGKVKVYHVNTFLYEE--VGVKKIKEKVERPLektdgeP-LKVAVHYG 160 Methanopyrus ka...
WP_010877481  82 FGSLFEANHLLKEDEEMRAKINEILKEAGREYKGEINVRHLAEILYND--VGLDKLSEVVEKPL------N-LNVAVHYG 152 Methanothermoba...
WP_010870248  82 YGSLYEANHLLKENEKARKMVNEILSKYGLEYKGKVRVRHLPEVLYYD--LGVDRIKEEITNPL------N-VNVAVHYG 152 Methanocaldococ...
WP_010870378  82 YGSLFEAAHILHENKEALDFVNEKLDKIGKQYKGTIKVRHFAELIYKD--IGVDKIKEKVVKPL------DvLNVAIHYG 153 Methanocaldococ...
WP_011406600  82 FGSLHEANDLLKEDKEFKEKVNGSLSEIGREFKGESNVRHFAEVLYND--IGLEKIAEAFEKDL------N-LNVAVHYG 152 Methanosphaera ...
WP_011448821  83 YKSIWEVNHILKHNDELRDNVNEVLAEIDMQFKGTIDVWHLAELYYDDkvCGVQKIKDSVTTPLs-----G-AKVAAHYG 156 Methanospirillu...
WP_011032930  95 YGSLADANMELKKDPEMKACTNSCLKEIGMEFRGTSEIRHIIEFLYKE--FGPEKLKEYITTPL------D-LKVALHYG 165 Methanosarcina ...
WP_011018942 161 CHLLKPSEVTGFpGSVEDPRTLDELVEALGAESVDYKDKIMCCGAGGGVRSRELKVSLHFTREKIFNMLEAGADCTTNVC 240 Methanopyrus ka...
WP_010877481 153 CHFLKPSEEINI-DNPERPTILDELVEVTGAKSVDYKDKMMCCGAGGGVRSRDLDVALDFTMEKLRNMKEAGVDAIVNVC 231 Methanothermoba...
WP_010870248 153 CHYLKPTDIKKL-ESSERPRSFDELVEALGAVSVNYKDKNMCCGAGGGVRARNLDVALKMTKTKLENIKEAKADCITEVC 231 Methanocaldococ...
WP_010870378 154 CHFLKPSDVKHL-DSPERPKLLEEIVAATGAKPVMYRDYLMCCGAGGGVRARFLPTALDMTKEKIRNMLEAGADCTVNVC 232 Methanocaldococ...
WP_011406600 153 CHFLKPSDEIGI-DNPKNPKILDELVEITGAKSVPYADKMMCCGAGGGLRARDLDVTTSFTHEKLENMKAAGVDAIVDVC 231 Methanosphaera ...
WP_011448821 157 CHLMKPKKERHF-GDTENPMWFEELIGALGAEPIQYRNKMQCCGAGGGVRGYDIVHALDITNEKLINIQEAGADAITELC 235 Methanospirillu...
WP_011032930 166 CHLIKPSKDRNL-GDTESPVFFDELVEATGAKSVDYTDKMMCCGAGGGVRSGYADESLEMLEHKLDCICKAGVDCIVNAC 244 Methanosarcina ...
WP_011018942 241 PFCHLQFDRGQIEMKEHFEKlpPKKLPVFHYCQLAGLAFGMDPEELALETHEIDCTPVLEKL 302 Methanopyrus kandleri
WP_010877481 232 PFCHLQFDVGQMEIKDKFGE--EFDIPVLHLAQLLGLAMGLPKEDLVVDAHQVCVDECLEKL 291 Methanothermobacter thermautotrop...
WP_010870248 232 PFCHLQFDRGQVEIKEKFGE--EYNIPVIHYSQLLGLAMGMSPKDVALDLHFIPTDEFIKKI 291 Methanocaldococcus jannaschii
WP_010870378 233 PFCHLQFDRGQVEIKEKFGE--EYKLPVLHLSQLLGLAFGMKPEDLAVSVHAIPVDPVLKKL 292 Methanocaldococcus jannaschii
WP_011406600 232 PFCHMQFDVGQTEVNERYNT--DFAIPVLHLAQLYGLAMGLSPEDLTLDKQVVDPAELVQKM 291 Methanosphaera stadtmanae
WP_011448821 236 PFCQLQFDRGQIEIKEKFGD--VYNIPVLHYNELLGLAQGMSPQDLALDLHAIDCTPFLQKV 295 Methanospirillum hungatei
WP_011032930 245 PFCHLQFDRGQIAVNEKFGT--DYSIPVLHYSQLLGLALGFSPDQLGIEQNAVQNIEFLAKI 304 Methanosarcina mazei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap