Conserved Protein Domain Family
methan_mark_15

?
TIGR03286: methan_mark_15 
putative methanogenesis marker protein 15
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. Related proteins include the BadF/BadG/BcrA/BcrD ATPase family (pfam01869), which includes an activator for (R)-2-hydroxyglutaryl-CoA dehydratase. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132329
View PSSM: TIGR03286
Aligned: 5 rows
Threshold Bit Score: 742.806
Threshold Setting Gi: 499328458
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010877471   2 VKIAQISCGTDYSGVQKEIEKAAETFGAEIVIPEADLDYIDEAYEKFGFNCASSSIKLMIARAMSLVEGKTDADAVFIAT 81  Methanothermoba...
WP_011032865   9 VKIALVSCGSEYAGVQPEFDEAAAKVKAKFIFPEVDVASIDTIGRDFGLEVASGDLRLMMARAKAVVEGTTNADGVFITT 88  Methanosarcina ...
WP_011449270   6 VRIAQLSCGPEYSGVQKEIYTAAEAVGAEVFFPDLSLSDIRRNFRDFGLDVKSGDLKLAIARAVALVEGSAEADAVFIAS 85  Methanospirillu...
WP_010870310   5 VKIALLTCGAEWSGVYHEIEKAAQKVGGELIFPEVDLSYIDEVEDRLGFKVGSANLKLMFARAMSIIEGNTDAEAVFIAT 84  Methanocaldococ...
WP_011018950   3 VQIAQLSCGTEYSGVQPEIERAAERVGAEIVLPEVDIDIVEEACEEVGYTPKSANLKVLLARAYALANGYAEADAAIILT 82  Methanopyrus ka...
WP_010877471  82 CFRCAEGALVRNELRRFIQQNTRLPVVTYSFTERTKADELFIRMEALATIVARKSILAREKQEGLTLGIDSGSTTTKVVL 161 Methanothermoba...
WP_011032865  89 CFRCAEGAIVRNEVRRYIHRHSNIPVISYSFTESTTAGTLLTRLEALTTIVRRRHLLTREVQHGLTAGIDSGSTTTKAVV 168 Methanosarcina ...
WP_011449270  86 CFRCAEAAIVRNELRRYIHEHSRLPVVSYSFTERTTSGTLLTRMEALTTIARRRALLARERQTGLTMGVDSGSSTTKAVI 165 Methanospirillu...
WP_010870310  85 CFRCAEGALVRNEVRKLIQQNTNLPVVMYSFTERTKASELLTRMEALTTIVERKSLLARKKQEGISLGIDSGSTTTKAVV 164 Methanocaldococ...
WP_011018950  83 CFRCAEGALVRSEARRYLQENTDLPVVTYSFTEDLDASELLTRMEALVTIVERKGLLARKRQEGLTLGIDSGSTTTKAVV 162 Methanopyrus ka...
WP_010877471 162 MEDNEVIGTGWLPTTDVIGSAEKGIEEALSGTGYKLEDIDGMGVTGYGRLTIGKHYGADLIQEELSVNSKGAVFLADHQK 241 Methanothermoba...
WP_011032865 169 MKDNKIIGKGWVPTTKVIESAEEAYSIALKEAGVSREEVQAMGTTGYGRFLIGNHFNAQLIQEEITVNSKGAVYLADRQK 248 Methanosarcina ...
WP_011449270 166 MQDNEIIGTGWRPTTEVLTSADEVIALALEEAGVTREDLDAVGTTGYGRFLIGERIGADLIQEELTVNSKGAVFLADCQH 245 Methanospirillu...
WP_010870310 165 MIDDEVAGTGWIYTKDVIESAKEAVNNALKEAGISLDQVETIGTTGYGRYTVGEYFKADLIQEELTVNSKGAAYLADKQE 244 Methanocaldococ...
WP_011018950 163 MEDDEVIGTGWVRTTKVVESAEKAVERALEEAGYELDDIEAIGVTGYGRYTLGRHFDADLVQEELTVNSKGTVYLGDKQE 242 Methanopyrus ka...
WP_010877471 242 GEATVLDIGGMDNKVITVNDGIPDNFTMGGICAGASGRFLEITARRLGVEIDELGSLALKGTYRKALLNSYCIVFGIQDL 321 Methanothermoba...
WP_011032865 249 GPATVIDIGGMDNKAISVEDGIPGMFTMGGICAGASGRFFEMISKRLGVDITELGALAVKGMHENVSMNSYCIVFGIQSL 328 Methanosarcina ...
WP_011449270 246 GPSTVIDIGGMDNKAISVLDGIPGTFTMGGICAGASGRFLEMTAKRLGVDITELGPLAMKGMGEDVPMNSYCIVFGTQSL 325 Methanospirillu...
WP_010870310 245 GEATVIDIGGMDNKAISLYDAIPDGFTMGGICAGASGRFFEITARRLGVSLQELGELAAKGDWRKIKMNSYCIVFGIQDL 324 Methanocaldococ...
WP_011018950 243 GGATVIDVGGMDNKAITVWDGIPDNFTMGGVCAGASGRFLEVAADRIGVDLDKFGKLALEGDPEAVRLDSYCIVFGIQDL 322 Methanopyrus ka...
WP_010877471 322 VTALAAGTSREDAAAAACHSVAEQVYEQQLQEIDVREPLIQVGGTSLIEGLVKAVSDILgGIDVIVPPYSQHIGAVGAAL 401 Methanothermoba...
WP_011032865 329 VNSLAKGSTPEDVAAAACYSVVEQIYEQQLQEVDVKEPLILVGGSSLIEGVPKALGKLL-KIDVLVPENSHLIGAVGAAL 407 Methanosarcina ...
WP_011449270 326 VNALAEGHSKENVAAAACHSVAEQVFEQQLQEIDIKEPVVMVGGTSLIQGLVRAMGNLL-QTEIVVPHHSQYIGSVGAAL 404 Methanospirillu...
WP_010870310 325 VTALAEGAKAEDVAAAAAHSVAEQVFEQQLQEVDVRDPVILVGGSSLLKGLVIAMEEVL-GRKIIVPRYSQLIGAVGAAL 403 Methanocaldococ...
WP_011018950 323 VTALAEGADPEDAAAAACRSVAEQIYEQQLQEIDIREPVFFVGGTSLVDGMVKALEDVI-GVEVVVPEYPQYIGAVGAAL 401 Methanopyrus ka...
WP_010877471 402 LVSGM 406 Methanothermobacter thermautotrophicus
WP_011032865 408 LASGF 412 Methanosarcina mazei
WP_011449270 405 LSSGF 409 Methanospirillum hungatei
WP_010870310 404 LSSGY 408 Methanocaldococcus jannaschii
WP_011018950 402 LASNY 406 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap