Conserved Protein Domain Family
methan_mark_12

?
TIGR03281: methan_mark_12 
putative methanogenesis marker protein 12
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. [Energy metabolism, Methanogenesis]
Statistics
?
PSSM-Id: 132324
View PSSM: TIGR03281
Aligned: 7 rows
Threshold Bit Score: 430.338
Threshold Setting Gi: 499766765
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011405639   4 YMGMDHGTTAISFEIIDENKEEvsYF--KLNRDK---LSKKEIFFkdIINDKIDIKKVKLLAMTYAMGDGISKITPIDLV 78  Methanosphaera ...
WP_010870887   3 TVGIDHGTSGITTCIKDNDKKI--IF--KLKRTE---LKEKSYLE--ELEKHISLEDIDLIALTYSMGDGINKILPIEKV 73  Methanocaldococ...
WP_010877051   6 FVGMDHGTTGVSFTILGDDAE---HF--KIGRED---LSTGRASAldELKDRVPLNEIDLMAITYAMGDAISTIKPIERV 77  Methanothermoba...
WP_011170586   3 VVGIDHGTSGITACVMENKTVKs-VF--KMKRTE---INEKSFLK--ELEKQVNLNDIDLIGVCYSMGDGIDKITDIKRV 74  Methanococcus m...
WP_011032630   3 FIGVDHGTTAMRFALIEGEKVL--TF--ELGRSEaaaMSEKEILEsiEKEFEVKVKDIDLIALTYSMGDGFSEIKDVKKI 78  Methanosarcina ...
WP_011018450   5 YVGIDHGTSGIKVAAYDGEGDP--EFlgKAPRRK---VAERGLLRslPDEARRAVEEAECICLNYGMGDALTEFTPLEEA 79  Methanopyrus ka...
WP_011447499   2 FVGIDHGTTAMRFA--GGEK----VY--KIPRAD------AVSFQlsDLLHLTGGEEIEGFAVTYSMGDNFSDITPVAHL 67  Methanospirillu...
WP_011405639  79 KD----RGIQSINGAGKVTGGGTTVYEDIMELNIPSVLIPGLHSGCEFLDDRFRASYSHCGSPEKVSLSYYAYLKTGFKN 154 Methanosphaera ...
WP_010870887  74 KN----RGVLSIEGAGEKVGGGTKVYDEIKESGLPAVVIPGLHRGIECLDERFRALYSHIASPEKVSIAYYAYKLFGFND 149 Methanocaldococ...
WP_010877051  78 KN----RGIISIGGAGKVTGGGTAVYSEIESSGIPTLLIPGLHRNTPCLDERFRAAYSHHASPEKVSICYNAYLETGWEN 153 Methanothermoba...
WP_011170586  75 EN----RGVINLEGIGKKIGGGTKVYDEIKSSNIPAIVIPGLHNGVKSMDKRFNALFSHIASPEKISICYNAYKTFGFEN 150 Methanococcus m...
WP_011032630  79 EG----RGLQSTEGAGKKTGGGTRVFDAVKNSGIPAIAIPGLHTRSK-VDPRMK-VFSHLTSPEKLGIAYHIRCM-GYKD 151 Methanosarcina ...
WP_011018450  80 EDlgvgYGLRDTSGAGREFGAGRRMVEELSELGVEAYLAPGIHRDLPRLDGAFR-VFSHVASGEKLGTARLALELSSSKD 158 Methanopyrus ka...
WP_011447499  68 KN----RGLVSREGAGEHTGGGTRVFDVIRESGIPAVAVPGLHRGSP-TDPRFK-VYSHQASPEKIGLAYEVVCQLG-PT 140 Methanospirillu...
WP_011405639 155 MIIADISSNTVCILVEDGKIKGAMDACVGAMGFIHGPLDLDMIRDIDSGKKTANEAFSHAGISKIA-CVDSQINNVKDDI 233 Methanosphaera ...
WP_010870887 150 FVLSDISSNTVTLLIKDGKIFGGFDACIGAIGMLHGPIDLEMIRDIDAGKITANEAFSKAGAVKIA-KLYKGVENTKEEI 228 Methanocaldococ...
WP_010877051 154 MIVSDISSNTVTMLIQDGRIVGAMDACVGAMGVIHGPLDLEMLRKIDDGEKTANECFSHAGAVKIA-GIDTKVSRAREEL 232 Methanothermoba...
WP_011170586 151 FILSDISSNTVTLLIKDGKIFGGFDACVGAVGILHGPIDLELIRNIDADKITANEAFSKAGVVKVT-DSYKGVEDTKFEI 229 Methanococcus m...
WP_011032630 152 FVVSDISSNTVTLAVASGKVIGAIDACIFAPGVHHGPLDLEAIRNVDDGLRTANQAFMEAGALKMT------PYKDRGEL 225 Methanosarcina ...
WP_011018450 159 IVVCDTSSNTVSVVVKDGEVIGGIDACLGAPGVLQGPLDLEAIRRIDAGELSANGAFSTGGIVKIVnCAGEDPESAVEEF 238 Methanopyrus ka...
WP_011447499 141 CIVSDISSNTVTLLIQDYRIVGGFDACLFAPGWVHGALDLDAIRAIDAGKMTANDAFLHAGVRDSL-------------- 206 Methanospirillu...
WP_011405639 234 LEKAlHNDKKGLLAIRSLVMSVIMEIYGLY-GImENKIDGIVLTGS-GGCMTSPINISGMIKEKIEr-iCPVYVLGSDSG 310 Methanosphaera ...
WP_010870887 229 INNY-FNDENCRLAVDSLILSVSMEINSLLpLL-DKNKRRVVLAGS-IGTLRNPIDIPKRIKEFVE---AKIFVLYGESG 302 Methanocaldococ...
WP_010877051 233 LEMYrAGRDEARLALDTMMMTIAMEIWGLA-GI-SSGIDGIVLTGS-VGAMREPYDFHGKLKDMVKe-iADVRCTDSHLR 308 Methanothermoba...
WP_011170586 230 MNNY-DKDEKCKLAVDSLVLSVSMEINSLM-FL--TPDKNVILAGS-IGTWENP-NVSKMIKENID---GNVLVLNRESG 300 Methanococcus m...
WP_011032630 226 LNAAeNGEEPALLALDTISLFAAMEIVSMQ-LL--LKEYGVTGAAFlAGSVGEVEYVQKKISRHLG---QECLSLGKWHA 299 Methanosarcina ...
WP_011018450 239 IQRC------GKEEKEWLARLVAWEVAGLG-VVyDCDEAWI------GGTLSGDDEFMGVLERVLSkafNKVAGLPPESA 305 Methanopyrus ka...
WP_011447499 207 -------DDPDREA--ALAMFAAMECASLR-LL--APEAPVALCGSrAGSVADE------IARLLS---CDLLILDEWTA 265 Methanospirillu...
WP_011405639 311 AIGSSYIAYDIEKNKVDkIMGIDVIY 336 Methanosphaera stadtmanae
WP_010870887 303 AIGGALIAEDILKGKRD-ILGIEVEF 327 Methanocaldococcus jannaschii
WP_010877051 309 LHGKCQIARDIYNGKRE-ILGIEVEV 333 Methanothermobacter thermautotrophicus
WP_011170586 301 AIGSAMIAEDILNGKKE-ILGIPVDF 325 Methanococcus maripaludis
WP_011032630 300 AIGCAGIARDVFAGENH-ILGIDVDY 324 Methanosarcina mazei
WP_011018450 306 SMGLALIAADIASGARS-VLGVRISR 330 Methanopyrus kandleri
WP_011447499 266 AKGLSRIAEAVFSKNVTqILGIPVRL 291 Methanospirillum hungatei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap