Conserved Protein Domain Family
cyano_FeS_chp

?
TIGR03279: cyano_FeS_chp 
putative radical SAM enzyme, TIGR03279 family
Members of this protein family are predicted radical SAM enzymes of unknown function, apparently restricted to and universal across the Cyanobacteria. The high trusted cutoff score for this model, 700 bits, excludes homologs from other lineages. This exclusion seems justified because a significant number of sequence positions are simultaneously unique to and invariant across the Cyanobacteria, suggesting a specialized, conserved function, perhaps related to photosynthesis. A distantly related protein family, TIGR03278, in universal in and restricted to archaeal methanogens, and may be linked to methanogenesis.
Statistics
?
PSSM-Id: 132322
View PSSM: TIGR03279
Aligned: 7 rows
Threshold Bit Score: 801.638
Threshold Setting Gi: 499455305
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010995384   8 RITKVLPDSIAAEIGFEAGDALVAINGVQPRDLIDYKFLCSDEFLELEVLDASGKTHHIEIEKDYDEDLGLEFETALFDG 87  Nostoc sp. PCC ...
WP_011057484  10 LVAAVKPGSIAAELGFEPGDALVAINGDRPRDLIDYRFLCADEYLTLEVLGKDGQTYILEIEKEIDEDLGLEFTTALFDG 89  Thermosynechoco...
WP_010871911  10 KISTVLPGSLGEEMGFEPGDAIVRINGQAPRDLIDYQFLCADDYLELDVLDSQGELHELAVEKEFDQDLGLGFETALFDG 89  Synechocystis s...
WP_011378258  10 RISRVLPDSIAAEIGFEPGDAIISINGQQPRDLIDYQFLCSDEFLELEVLDAAGRSHQIEIEKDTDEGLGLEFETALFDG 89  Synechococcus e...
WP_011124272  27 LIKIVDPGSIGEDLGFEAGDQLLTINGVKPRDLIDYKYLIAEEELELEVLDKNGERHNIQLEKNLDDDLGLIFTEALFDG 106 Prochlorococcus...
WP_011129560  17 VVASVEQGSIGEQLGFEPGDQLLSVNGVRPRDLIDYRYLIVEEELHLEVRDATGAFHQVDLEKDSDDGLGLAFTEALFDG 96  Prochlorococcus...
WP_011142769  10 VVSAVRPGSIAEELGFEPGDRLVSINGTAPRDLIDYQFLCAEQSLALTVLDREGHSHSLEVEKDLDEDLGLEFATALFDN 89  Gloeobacter vio...
WP_010995384  88 LIQCNNRCPFCFIDQQPPGKRSSLYLKDDDYRLSFLYGSYLTLTNLPEREWQRIEQMRLSPLYVSVHATEPEVRIRLLKN 167 Nostoc sp. PCC ...
WP_011057484  90 LMQCNNRCPFCFIDQQPPGKRESLYIKDDDYRLSFLYGSYITLTNLLPSEWQRIARLRLSPLYISVHATVPSIRQRLLKN 169 Thermosynechoco...
WP_010871911  90 LIQCNNRCPFCFIDQQPPGKRESLYYKDDDYRLSFLYGSYLTLTNLSAKEWQRIEQLRLSPLYVSIHATEASVRERLLKN 169 Synechocystis s...
WP_011378258  90 LIQCNNRCPFCFIDQQPPGKRESLYYKDDDYRLSFLYGSYLTLTNLSEAEWRRIAQLRLSPLYVSVHATEPDLRRRLLKN 169 Synechococcus e...
WP_011124272 107 LKQCNNNCSFCFIDQQPAGRRQTLYVKDDDYRMSFLYGSYLTLTNLMPKDWERIEAQRLSPLFVSVHATDSKLRSQLLKN 186 Prochlorococcus...
WP_011129560  97 LRQCNNRCPFCFIDQQPLGRRNSLYLKDDDYRLSFLYGSYLTLTNLKEADWQRIEAQRLSPLFVSVHATEPSLRAQLLKN 176 Prochlorococcus...
WP_011142769  90 LIQCNNGCAFCFIDQQPDFMRDTLRLKDDDYRLSFLYGSYLTLTNLPPAEWERIARLRLSPLFVSVHATEPDLRARLLKN 169 Gloeobacter vio...
WP_010995384 168 TRAAQILDQLRWFQTRRLQIHAQVVVCPGINDGKHLEQTLRDLASFHDRDVPTVASVAVVPVGLTRFRPEEDELIPVTRE 247 Nostoc sp. PCC ...
WP_011057484 170 PRAGEILQQIRWFQEQRLQLHAQVVVCPGINDGECLEQTLRDLAQFYDPDWPTVLSVAVVPVGLTRFRPAEDELTPVTPD 249 Thermosynechoco...
WP_010871911 170 HRAGQILDQLAWFQARRLQIHAQVVVCPGVNDGKHLEQTLRDLAQFHQGETPAVISVAVVPVGLTRFRPQEDELSPVGQA 249 Synechocystis s...
WP_011378258 170 ERAGLIGEQLHWFRQQQLQIHAQVVVCPDLNDGAQLQRTLMDLAEFHRGDPATVASVAVVPVGLTRFRPTEDELRPVQPA 249 Synechococcus e...
WP_011124272 187 DKAGLIMEQIKWFAEKKLQLHAQIVVCPGINDGKNLAKTINDLFQYAQGTWPAIISTAVVPVGLTRFRPDQDGLQPVNEE 266 Prochlorococcus...
WP_011129560 177 PRAGLLLEQLKWFSERDLQVHAQVVVCPGLNDGLALDRTLRELADFGTGDWPAVLSVAVVPVGLTRFRPEEDGLLPVGSA 256 Prochlorococcus...
WP_011142769 170 PRAGFILEQLAWFKTHGLQLHAQVVLCPGLNDGEHLERTLTDLARFHDLESPTVLSAAVVPVGLTRFRPEGDELTAVTPE 249 Gloeobacter vio...
WP_010995384 248 KAQEVIAQVRSLTQEFRRQFGSNVAWLADEWFLIAGEELPSEAEYEEYPQIDNGVGSIRLFLKQFAETaAELLPAKINHP 327 Nostoc sp. PCC ...
WP_011057484 250 HAQAVIQRVQALQQQFERQWQTPFAWLADEWFLMAGWPLPPAAHYQDYPQLSNGVGTIRLFLEEFDLH-APQLPQRLPQP 328 Thermosynechoco...
WP_010871911 250 KATEVIAQVQALQKEFAQQLGGNFVWLADEWFLIARQPLPPESHYEDYPQIGNGVGSIRQFIKEFQQQaAEFLPPAIAEA 329 Synechocystis s...
WP_011378258 250 DAAATIALVEALQTQFQTELGSRFAWLADEWYLIAGQPLPSASWYEQYPQLENGVGSIRAFISEFERQ-AATLPSQIEPA 328 Synechococcus e...
WP_011124272 267 CAKKVISLVERMQTDFQSKIGSRFAWLSDEWYLIANKQLPHRVAYEDLPQEENGVGSIRSFLEAMDIV-TQHLPKKISKK 345 Prochlorococcus...
WP_011129560 257 CARRVISQVELLQDQFQAVMGTRFAWLSDEWYLIAGAPLPPRSTYEDLPQQENGVGSIRSFLEALDQA-TVILPKRLRQP 335 Prochlorococcus...
WP_011142769 250 VARRIIRQVHRLQKDFRRSLGSRFAWLADEWYLLAAEKLPGRAHYEGYPQLGNGVGSLRRFLDEFGRL-ERRLPASIAPA 328 Gloeobacter vio...
WP_010995384 328 KKLTWVVGNAVEKAFQPILKSLNAVEGLEINMRALSSDYWGQTISVTGLITGHDLLLHLKEQDLGGGILLPNVMLKHGEL 407 Nostoc sp. PCC ...
WP_011057484 329 RHLSWVVGNTVEQAFEPLVARLNQIENLRLDLYALASDYWGQRLSVTGLLTGHDLIYHLQGKPLGDRLLLPSLMLKHDAA 408 Thermosynechoco...
WP_010871911 330 KTLTWVVGNAVEQAFELLVEQLNQVKGLTVNLAPLNSDYWGQEITVTGLLTGQDLIAKLAGRDLGDGILLPALMLKHDDT 409 Synechocystis s...
WP_011378258 329 RRLTWVVGNVVEQAFQPLQARLNAVQGLQVDLVGLASRYWGQTLTVTGLLTGQDLIEALSDRDLGDGLLLPSVMLRHGDR 408 Synechococcus e...
WP_011124272 346 KTCSWVVGKLVEQALSPISLRMNRIEGLSLKVFGLASPYWGKEKVVTGLLTGQDIINGLKNKELGDELLLPSVMLKHDEL 425 Prochlorococcus...
WP_011129560 336 RRCSWVVGRLVEQALGPACERLNAVEGLAVELHGLPSPYWGQDQVVTGLLTGHDLLEGLKALDLGDQLLLPSVMLRQGEL 415 Prochlorococcus...
WP_011142769 329 RRYSWVVGTAVADCFAPVAERLNRIDGLELTMHALPSLFWGQQITVTGLLTGGDLLAGLAHKDLGDALILPGLMLKEGR- 407 Gloeobacter vio...
WP_010995384 408 VFLDDMSVEEVARQLQTKILPIAGVEELIKTCIT 441 Nostoc sp. PCC 7120
WP_011057484 409 VFLDDVPLATVEEALGVPIQVVSGGAAGIIAACT 442 Thermosynechococcus elongatus
WP_010871911 410 RFLDDLRVADVAQKLGTTIYPVADVASLLEHCVQ 443 Synechocystis sp. PCC 6803
WP_011378258 409 CFLDDLTVAEVEKALHTPIFVAEGITGLLTECLR 442 Synechococcus elongatus
WP_011124272 426 KFLDDVTVEEVANNLKIPIKIILGPDDFVEHLIG 459 Prochlorococcus marinus
WP_011129560 416 VFLDDMTLEQLSEALQISIRIVHGAADIVAAAMG 449 Prochlorococcus marinus
WP_011142769 408 MFLDDLSVEEFTARLGVAVRVVAGGAGALVDALT 441 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap