Conserved Protein Domain Family
methan_mark_10

?
TIGR03278: methan_mark_10 
methanogenesis marker radical SAM protein
Members of this protein family, to date, are found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. It is a radical SAM enzyme by homology. The exact function is unknown, but likely is linked to methanogenesis. In most genomes, the member of this family is encoded by a gene next to, and divergently transcribed from, the methyl coenzyme M reductase operon.
Statistics
?
PSSM-Id: 132321
View PSSM: TIGR03278
Aligned: 6 rows
Threshold Bit Score: 698.392
Threshold Setting Gi: 499328528
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010876794   7 LGGIPGKDCRGFCRYCYFRKVGEF--EAFGCKNCSPGRVGCETCGKGVaEIGNEFLPPFLVMGNVQTTLmMGNFqdRDVK 84  Methanothermoba...
WP_011405908   7 VGGIPGKNCRGFCEYCYFKKVTQK--KVLGCKNCPPGQIGCPHCTTDT-NMTRDYFPPYQVLSSLQTNI-FQTRlpKDTL 82  Methanosphaera ...
WP_011033194   7 VGGNPGVDCRGFCKYCYFKKVKDV--QPLGCKYCLPFKKGCDYCTRSVkESYSGFKPLQMVLEETANKLyFATG--EVKK 82  Methanosarcina ...
WP_011449470   8 IGGRPGIDCRGFCAYCYFKHAQDL--PAFGCKYCLPFTKGCDYCSRSVqEKYSGFIPLQEVAGKVLADLqMLTG--DLTR 83  Methanospirillu...
WP_010870355  10 LRGEPGINCNGFCKFCYFRKVNKNnpQPFGCRYC-QFTVGCDYCMYSVrEINGDFIPLPFALMELQSSLlFK----RYSK 84  Methanocaldococ...
WP_011019020   1 MGGRPGVDCGGFCRYCYFRGVDWEekRPFGCKNCPPGSPGCDYCGRSVwEDNGPFRPPGVVLQEVGMSLgFR----RERE 76  Methanopyrus ka...
WP_010876794  85 INISGGGDVSCYPHLEELTAGLGEFGIP-IHLGYTSGKGIDDPGIASRLIENGVDEVTFTVFSANPDLRREWMRDENAfQ 163 Methanothermoba...
WP_011405908  83 VNITGDGDVSCYPHLLELTKGIHDMGLP-IHLGYTSGKGIDDVSTVDKLINNGVIETTYTAFSTDAKLREKWMHDPTA-D 160 Methanosphaera ...
WP_011033194  83 FTVSGGGDLSCYPELKNLITFLSQFNTP-IHLGYTSGKGFSKPDDALFYINNGVTEVSFTVFATDPSLRAEYMKDPEP-E 160 Methanosarcina ...
WP_011449470  84 ITISGGGDPSCYPEFTDLMELLSSLEAP-IHIGYTSGKGFDNPDIAEFLIENGLREISFTVFAHDPELRRKYMKDPTP-E 161 Methanospirillu...
WP_010870355  85 VNLTAGGDVSCYPQLEELCKAINNIGLK-IHLGYTSGKGFDNVEIAKNLVDYGVDEVTFSVFSTNPKLRKEWMNDKNA-E 162 Methanocaldococ...
WP_011019020  77 ATVSGGGDISNYPWLRELVASLRDLGIRsVQLGYTSGKGFEDPEEVEELCDLGVRSVSYTVFAWDPELRREWMGDRSP-E 155 Methanopyrus ka...
WP_010876794 164 GPLEALRIFCESCE-VHAASVIIPGVNDGDDLLETCARLEEWGATGFIMMRFANYEHQGLILGNEPIIEGVEPHTVSEFE 242 Methanothermoba...
WP_011405908 161 VSIQALKRFCESCD-VHAASIIIPGVNDGDILAKTCADLESWGAKALILMRFANTANQGLILNNGPIIPGIKEQTLTEFE 239 Methanosphaera ...
WP_011033194 161 ASIQVLRDFCAHCE-VYGAIVLLPGINDGEVLEKTLSDLESMGAKGAIFMRFANFQENGLILNNSPIIPGIIPHTVSEFT 239 Methanosarcina ...
WP_011449470 162 ASLETLHRLAQKIE-VYAALVILPGVNDGKVLIDTIRWLEKAGVKGAILMRFANTPEQGLILQNAPIIPGQRIHTPLEFA 240 Methanospirillu...
WP_010870355 163 TALKCLRYFCENCE-VHCAIIVIPGVNDGEELKKTVSDLVDWGANAVILMRFANSEEQGLILGNAPLIEGIKPHSVEEFK 241 Methanocaldococ...
WP_011019020 156 ASLACLEVFADRCEeVMVAAVLIPGVNDGDVLWKTCERLEELGIDALLLMRLGTREEHGIILGNSLVLD-VKPHSLDEFK 234 Methanopyrus ka...
WP_010876794 243 ELVRAIDREFN--LRVTGTPVCDPQNGTPFVLAADSSrEYLEILPE-IQGEATIITGSIAAPYIRRIIHNLGADDLVNVV 319 Methanothermoba...
WP_011405908 240 NLVRETAKNYN--LRVTGTPVCDPETDAPYALSKDKNkEYLEILTP-VRAEATIVTSKISAPYIEKILENLNAADYVNVV 316 Methanosphaera ...
WP_011033194 240 EIVRSSAAKHPs-MRITGTPLEDPLIGSPFAIRNVP--EALSKLPG-VTKKATVLTGQVAAPRLTEIFDALGGS--VNVV 313 Methanosarcina ...
WP_011449470 241 DLVKETQKITS--IRISGTPLYDPDLGSPFILAHEP--DHLQTLPM-ISKCAGVITGAIAGPFLDQILRARGGENLIFMV 315 Methanospirillu...
WP_010870355 242 NIVDEIHNEFGdyIRVTGTPLHDPVAGTPFALAKEENsHILERLKDkINGEATIITGNVAYPFLKKIFDETS----VNVV 317 Methanocaldococ...
WP_011019020 235 RIVTEVHEEFP--FRVTGTPLWDPETSAPFALRTLGE-ELRELLPP-VEVECSLITGRVAAPLIREVFRHVEGGEKVDVV 310 Methanopyrus ka...
WP_010876794 320 GVNKDIACLITLRDLEEVDPGDLRETVIIPGRAFVHDMQAREVLSRDGVDRIVVRGPDRLTVDGEMSGTLSEYDVIEREM 399 Methanothermoba...
WP_011405908 317 STSQEIACLITEHDLREIDLNEVKDTVIIPGRCYVHDLVAEKIFRSDGKFRLIHRGPDMLTADGEMSGTLSKNDVLKQEL 396 Methanosphaera ...
WP_011033194 314 PLKKDIGCLITIDDFRNLDLSEVTETVFIPGRAFVHDMEVREALKKDGVDRIVRRGPERLSVDGEMSIGMTREEVLELEI 393 Methanosarcina ...
WP_011449470 316 --KKEIADLITIDDIQELDLSTMPDTIILPGRSFIHISEAEKVLSADGRSRIVIRGPDMLTADGETSMGMTRDEVLALEL 393 Methanospirillu...
WP_010870355 318 KVNKDIADLITAKDLEKLDLKDVKETVFIPPKAFVHDRVAEEILRRDGVDRIVVRGVEQLTLDGEVSGIYTREEALKFEI 397 Methanocaldococ...
WP_011019020 311 PVEKDVACLITERDLERLDVSSLKRTVVLPGRALVHDARAEELLKRDGFERVVLRGPDRLTLDGEASCEVDREEVLEFEL 390 Methanopyrus ka...
WP_010876794 400 EAFYELIQAINFFGA 414 Methanothermobacter thermautotrophicus
WP_011405908 397 MAFEDLIELINYMGV 411 Methanosphaera stadtmanae
WP_011033194 394 EGFTELINQINSLGL 408 Methanosarcina mazei
WP_011449470 394 EGCRTLINLINQWGS 408 Methanospirillum hungatei
WP_010870355 398 EAFEELIGMINFFGM 412 Methanocaldococcus jannaschii
WP_011019020 391 NAFRDLINTVNILGE 405 Methanopyrus kandleri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap