Conserved Protein Domain Family
methan_mark_9

?
TIGR03277: methan_mark_9 
putative methanogenesis marker domain 9
A gene for a protein that contains a copy of this domain, to date, is found in a completed prokaryotic genome if and only if the species is one of the archaeal methanogens. The exact function is unknown, but likely is linked to methanogenesis or a process closely connected to it. A 69-amino acid core region of this 110-amino acid domain contains eight invariant Cys residues, including two copies of a motif [WFY]CCxxKPC. These motifs could be consistent with predicted metal-binding transcription factor as was suggested for the COG4008 family. Some members of this family have an additional N-terminal domain of about 250 amino acids from the nifR3 family of predicted TIM-barrel proteins.
Statistics
?
PSSM-Id: 132320
View PSSM: TIGR03277
Aligned: 6 rows
Threshold Bit Score: 204.212
Threshold Setting Gi: 499179105
Created: 9-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011447706 256 GWYNAPKQLCRGGDIRSLAFCCMPVKPCPLLPKLQHYNISPQEFVTMKMEAVAGTPLEQGANTCFGSLVYCCKDTTPCMF 335 Methanospirillu...
WP_011406976   2 GWDDAPAHVCRGGDIRGLAFCCPPVKPCPVHTKLAEVGLSPQEFVNIKEEFGKKTELGKGTGTCFGSLIWCCKASKPCPL 81  Methanosphaera ...
WP_015412131 262 GWYNAPKHVCSEGDFRGLAFCCLPVKPCPVHAKFKKLGYTAEEFARTKLEFARGTMLEFGEDTCFGSLVWCCKITKPCWI 341 Methanosarcina ...
WP_011019800   7 GWPDAPSHVCRGGPPEALAFCCPPVKPCPIFHALDEAGLDPEEYVRRKKEFAEKTPLGSGKNTCFGSLVWCCKITKPCPL 86  Methanopyrus ka...
WP_010869607   2 GWENAPSHICRGGDLRGLAFCCPPIKYCPIHKALAVLKMSPEEFIRIKEEFGKRTKLGLGENTCFGSLVWCCKITKPCPY 81  Methanocaldococ...
WP_010876645   2 VWSDAPSHVCRGGDKRALTFCCPPVKPCPIMIALEEAGLTPQDYIEIKESFAKRTRLGEGQGTCFGSLVWCCKPSKPCPL 81  Methanothermoba...
WP_011447706 336 RDAALRQAGIKKSTYMDLKREISKKLLKK 364 Methanospirillum hungatei
WP_011406976  82 RDSVLQSIGMSHDTYMTLKKELANEIVKH 110 Methanosphaera stadtmanae
WP_015412131 342 RDGVLNTIDLSDAEYMKLKEKLAKHILDN 370 Methanosarcina mazei
WP_011019800  87 RDSTLQRIGMSPEEYMWWKKKLAEYLLGK 115 Methanopyrus kandleri
WP_010869607  82 RDYELAKNNISPDEYMELKKQLAEEIIRN 110 Methanocaldococcus jannaschii
WP_010876645  82 RDMAMKRINMSTEEYMELKKKLSEELVGT 110 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap