Conserved Protein Domain Family
Phn-HD

?
TIGR03276: Phn-HD 
phosphonate degradation operons associated HDIG domain protein
This small clade of proteins are found adjacent to other genes implicated in the catabolism of phosphonates. They are members of the TIGR00277 domain family and contain a series of five invariant histidines (the domain in general has only four).
Statistics
?
PSSM-Id: 132319
View PSSM: TIGR03276
Aligned: 10 rows
Threshold Bit Score: 229.172
Threshold Setting Gi: 499447927
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011396915   4 SQFLAELERLFDLYGHRN-Yg--EHCTQYEHMAQCGWWAQRQGGSTALIGAAFLHDIGHLLAEDRNLPgRDRWGYVHHDS 80  Hahella chejuensis
WP_010996378   2 KPTIENIINLFTEKGSQL-Yg-aEAISQLEHALQCASLAEASGQTHELITACLLHDLGHLIHDLGDNP-ASQGIDDHHEH 78  Nostoc sp. PCC ...
WP_011353968   2 ALTVEEIHGLYREHGHVA-Ys-gEPVTQLEHALQSGLLAEEAGADEALVAAAFLHDLGHLLNRQGETP-SARGIDDLHQY 78  Burkholderia lata
WP_009561136  14 KAVAEHIRALFDGPGSRQwYdgyEAVSQTRHALLCAQNAIAASAEGHLVSAAFLHDIGHLIDLNGRDK-FQSGTDAQHEE 92  Acidithiobacill...
WP_003813135   2 ALTLQDIEQIFLERGHRA-Yd-gEPVSHLKHALQTATLAEQGGAGPHLITASLLHDLGHLIAAHPGTP-SLRGLDDKHQY 78  Bordetella bron...
WP_011336412   5 EQVIDRVFGLYERFGASD-Yi-gEPVSQIEHMSQAAQLAIAEGFDDEVVLAAFFHDIGHLCA-EGAEN-MGGYGVVSHER 80  Pseudomonas flu...
WP_024917002   6 HRFLDELAERFASHGAEP-Yg--EAVSQAEHALQCATLAERAGCSDSLVVAALLHDIGHLYEDPAQID----EEDLRHEE 78  Pseudomonas aer...
WP_011436426  15 DEFCDELFAYLTAVGQSQ-Yd--ETVTQLEHARQTAALAEADGYDQAAQVAALLHDIGHLLLDEHDAHhNFLAEDLHHEI 91  Frankia
WP_011300299   1 MLTLPRIASLFASHGTAY-Yg-gEAISQTAHALQCAQLAEQAGEPEPLIVAAFLHDVGHLMLAESST------TDMRHQE 72  Cupriavidus pin...
WP_011135391   2 RQAIATLQQLYREHGARH-Yg--EAVSQFDHAIQAATLARDAGCDDELTLAAFLHDVGHLLEHDGAQA-MGGYGVMAHDK 77  Chromobacterium...
WP_011396915  81 LAESWLREHrLPESLVRPIALHVQAKRYLVATRPEYAEGLSTASKATLAQQGGPFTSQQCREFEADPASRDAIRLRELDE 160 Hahella chejuensis
WP_010996378  79 RAIPLLSQM-FSPAVTEPIRLHVVAKRYLCSVIPEYWENLSAASKRSLELQGGIFSPEQAEQFIQQPYAEDAVQLRIFDD 157 Nostoc sp. PCC ...
WP_011353968  79 YVLPFLRPL-FSDAVLEPIRLHVDAKRCLCRTDAGYFESLSPDSVRSLGLQGGIFSEEETAAFLQRPFAEDALRLRRWDD 157 Burkholderia lata
WP_009561136  93 IGANWLGQW-FPPSVTEPIRWHVAAKRYLCATEPSYPASLSLVSQRSLVLQGGAMSAGECAAFEKTCFSADAIRLRRWDD 171 Acidithiobacill...
WP_003813135  79 FVLPFLRGL-FGNAVLDPIRLHVEAKRYLCFVEPAYATRLSADSRRSLTLQGGSFDAGQAVDFASMPGAPDAIRLRRWDD 157 Bordetella bron...
WP_011336412  81 LGADYLREAgFSERMARLVEYHVQAKRYLTLRDPSYYHRLSEASRRTLEYQGGVMTEAEADAFERDPLCAVSLRMRQWDE 160 Pseudomonas flu...
WP_024917002  79 FGARLLREL-FPESVWQPVRLHVSAKRFLCAVDPSYHASLSPASRHSLVLQGGPFDERAAAAYIKAPYAQDGLTLRRLDD 157 Pseudomonas aer...
WP_011436426  92 VGARYLTRW-FGPDIGTPVALHVKAKRYLVATDPAYANSLSVASTRSLRVQGGPMTGREVDAFLCLPHADLAIALRRWDD 170 Frankia
WP_011300299  73 AAADALAEL-FGPDVTEPIRLHVAAKRYLCAVDAGYFSTLSEASVHSLALQGGPFDAAQASAFAAGSHADAAVRLRRYDD 151 Cupriavidus pin...
WP_011135391  78 LARDYLLQQgFSPRLARLVGMHVEAKRYLCSVDPAYLAALSPASAATLGYQGGPMRADEADAFSRLPDLADILALRRLDE 157 Chromobacterium...
WP_011396915 161 LGKAEEFELPPLKVWVSWLERHM 183 Hahella chejuensis
WP_010996378 158 KAKITNLHTPDLNHFTQFITASL 180 Nostoc sp. PCC 7120
WP_011353968 158 TAKEEGKVTPDLDHYMEIVARQV 180 Burkholderia lata
WP_009561136 172 HAKDPGKPLPDFQDVMAYIIRSV 194 Acidithiobacillus ferrooxidans
WP_003813135 158 QAKQPGMQTGSLTHFLEIAEGVA 180 Bordetella bronchiseptica
WP_011336412 161 LAKEMAVPVMDLALLKGKAFTVL 183 Pseudomonas fluorescens
WP_024917002 158 LAKDPAMRTPELTHFFPLLERLL 180 Pseudomonas aeruginosa
WP_011436426 171 NAKRAGVAVPELDHWRPAVCRLV 193 Frankia
WP_011300299 152 LAKVVDLVTPPVTHYMHMAARCL 174 Cupriavidus pinatubonensis
WP_011135391 158 AAKDGGWSLDAADWVWPLMAAHL 180 Chromobacterium violaceum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap